Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3924
Gene name
LocationContig_355:12053..15032
Strand+
Gene length (bp)2979
Transcript length (bp)2775
Coding sequence length (bp)2775
Protein length (aa) 925

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02366 PMT Dolichyl-phosphate-mannose-protein mannosyltransferase 2.1E-81 55 303
PF16192 PMT_4TMC C-terminal four TMM region of protein-O-mannosyltransferase 6.8E-66 553 751
PF02815 MIR MIR domain 1.3E-45 351 529

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33775|PMT1_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT1 PE=1 SV=1 44 829 0.0E+00
sp|O74189|PMT1_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT1 PE=2 SV=1 49 812 0.0E+00
sp|P52867|PMT5_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT5 PE=1 SV=1 55 765 5.0E-162
sp|O13898|PMT1_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ogm1 PE=1 SV=1 49 785 3.0E-149
sp|Q5ACU3|PMT5_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT5 PE=2 SV=1 58 758 1.0E-135
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33775|PMT1_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT1 PE=1 SV=1 44 829 0.0E+00
sp|O74189|PMT1_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT1 PE=2 SV=1 49 812 0.0E+00
sp|P52867|PMT5_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT5 PE=1 SV=1 55 765 5.0E-162
sp|O13898|PMT1_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ogm1 PE=1 SV=1 49 785 3.0E-149
sp|Q5ACU3|PMT5_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT5 PE=2 SV=1 58 758 1.0E-135
sp|Q9UKY4|POMT2_HUMAN Protein O-mannosyl-transferase 2 OS=Homo sapiens GN=POMT2 PE=1 SV=2 56 734 8.0E-132
sp|P31382|PMT2_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT2 PE=1 SV=2 44 752 2.0E-129
sp|P47190|PMT3_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT3 PE=1 SV=2 51 751 9.0E-127
sp|Q8BGQ4|POMT2_MOUSE Protein O-mannosyl-transferase 2 OS=Mus musculus GN=Pomt2 PE=1 SV=1 55 734 4.0E-126
sp|Q5ADM9|PMT2_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT2 PE=1 SV=1 33 751 5.0E-120
sp|Q29IL2|POMT2_DROPS Protein O-mannosyl-transferase 2 OS=Drosophila pseudoobscura pseudoobscura GN=tw PE=3 SV=1 6 752 4.0E-117
sp|Q9C100|PMT2_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ogm2 PE=3 SV=1 50 752 1.0E-110
sp|Q59X23|PMT4_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT4 PE=2 SV=1 64 741 1.0E-110
sp|P46971|PMT4_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT4 PE=1 SV=1 13 735 3.0E-108
sp|Q9W5D4|POMT2_DROME Protein O-mannosyl-transferase 2 OS=Drosophila melanogaster GN=tw PE=2 SV=1 6 641 2.0E-107
sp|Q9VTK2|POMT1_DROME Protein O-mannosyltransferase 1 OS=Drosophila melanogaster GN=rt PE=2 SV=2 58 753 2.0E-105
sp|P42934|PMT6_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT6 PE=1 SV=1 1 752 4.0E-104
sp|Q5A688|PMT6_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT6 PE=2 SV=1 54 751 1.0E-103
sp|Q2LZ62|POMT1_DROPS Protein O-mannosyltransferase 1 OS=Drosophila pseudoobscura pseudoobscura GN=rt PE=3 SV=2 58 759 4.0E-103
sp|O42933|PMT4_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ogm4 PE=3 SV=1 54 751 3.0E-98
sp|Q9Y6A1|POMT1_HUMAN Protein O-mannosyl-transferase 1 OS=Homo sapiens GN=POMT1 PE=1 SV=3 56 695 7.0E-96
sp|Q99PR0|POMT1_RAT Protein O-mannosyl-transferase 1 OS=Rattus norvegicus GN=Pomt1 PE=2 SV=1 56 687 2.0E-92
sp|Q8R2R1|POMT1_MOUSE Protein O-mannosyl-transferase 1 OS=Mus musculus GN=Pomt1 PE=1 SV=1 71 687 2.0E-91
sp|Q06644|PMT7_YEAST Probable dolichyl-phosphate-mannose--protein mannosyltransferase 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT7 PE=1 SV=1 132 694 3.0E-25
sp|Q93ZE8|SDF2_ARATH Stromal cell-derived factor 2-like protein OS=Arabidopsis thaliana GN=SDF2 PE=1 SV=1 283 526 1.0E-10
sp|Q9W5D4|POMT2_DROME Protein O-mannosyl-transferase 2 OS=Drosophila melanogaster GN=tw PE=2 SV=1 655 752 7.0E-08
sp|Q3SZ45|SDF2_BOVIN Stromal cell-derived factor 2 OS=Bos taurus GN=SDF2 PE=2 SV=1 352 461 2.0E-06
sp|Q9DCT5|SDF2_MOUSE Stromal cell-derived factor 2 OS=Mus musculus GN=Sdf2 PE=1 SV=1 352 465 3.0E-06
sp|Q54P23|SDF2_DICDI Stromal cell-derived factor 2-like protein OS=Dictyostelium discoideum GN=DDB_G0284847 PE=3 SV=1 334 495 4.0E-06
sp|Q9HCN8|SDF2L_HUMAN Stromal cell-derived factor 2-like protein 1 OS=Homo sapiens GN=SDF2L1 PE=1 SV=2 352 467 4.0E-06
sp|Q99470|SDF2_HUMAN Stromal cell-derived factor 2 OS=Homo sapiens GN=SDF2 PE=1 SV=2 352 465 5.0E-06
sp|Q9ESP1|SDF2L_MOUSE Stromal cell-derived factor 2-like protein 1 OS=Mus musculus GN=Sdf2l1 PE=1 SV=2 352 467 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006493 protein O-linked glycosylation Yes
GO:0000030 mannosyltransferase activity Yes
GO:0016020 membrane Yes
GO:0043412 macromolecule modification No
GO:0043413 macromolecule glycosylation No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0006486 protein glycosylation No
GO:0008152 metabolic process No
GO:0070085 glycosylation No
GO:0016740 transferase activity No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0036211 protein modification process No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0016758 hexosyltransferase activity No
GO:0016757 glycosyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 93 115 22
3 135 157 22
4 159 181 22
5 186 208 22
6 221 238 17
7 242 264 22
8 277 299 22
9 607 629 22
10 650 667 17
11 672 694 22
12 707 729 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3924
MAKSTASGGKSPPPPDRSSPTPRAKAKKIASYQSDGVEDHDVFLLPVSDYVVTLCVTVLATVVRIFRIYQPSSVV
FDEVHFGGFASKYIKGKFFMDVHPPLAKMLIALTGWLAGFDGNFDFKDIGKDYLEPGVPYVAMRMFPAVCGIALA
PFMFLTLKAIGSRTMTAAMGACLIIFENGLLTQARLILLDSPLVAATAFTVLAFTCFTNQHEQGPAKAFKPAWWF
WLAMTGLGLGTTVSIKWVGLFTIAWVGILTLVQLWVLLGDNRNVTLRLWTKHFMARIFCLVIIPVTFYLAMFAIH
FVCLVNPGDGDGFMSSEFQATLNSKGMKDVAADVVLGSRITMRHVNTQGGYLHSHPLMYPTGSKQQQITLYPHKD
ENNVWLIENQTQPLGSDGQPINGTFAWDQLSDGPRYVTNGMVIRLYHQPTHRRLHSHDVRPPITEAEWQNEVSAY
GFDGFEGDANDLFRVEIVKKKSSGAVAKERLRTIETKFRLVHIMSGCVLFSHKVKLPDWASEQQEVTCARSGSLP
NSLWYVEYNEHPQLGEGVEKVNYRNPGFLGKFWELQQVMWRTNAGLVESHAWDSRPGSWPILRRGINFWGKHHTQ
IYLIGNPIVWWSSTLAVVVWVMFKAIAVLRWQRSCNDYSSATFKRFDYEIGTYVLGWMLHYFPFYLMQRQLFLHH
YFPALYFAVVALCQMFDYLTVRIPGVGARDGAVVNKAATVCFLVLSAAAFTLYAPLAYGNHWTKSECSRVKVLGT
WDWDCNNFYDSYEAYSSEGSLASPPAASTTAAKKSVEKVAAEISSPSPPPGPRVVSLEESVEYRDQDGNLLNAEQ
VEKLKGKVDFQTHYETRTRVLDEQGNELPMPEGGWPADLDAGVAPPHPDVEGVDKETVKAGGAEPPRHAAASRDG
EREAEWAKAKPGSEGKDATVRDEL*
Coding >Ophun1|3924
ATGGCCAAGTCCACCGCCAGCGGCGGCAAAAGCCCTCCGCCGCCGGACCGCTCCTCTCCGACACCGAGAGCCAAG
GCCAAGAAGATCGCCTCGTACCAGTCGGACGGAGTCGAGGACCACGATGTCTTCCTGTTGCCCGTGTCCGACTAC
GTCGTCACTCTCTGCGTCACCGTCCTGGCCACCGTCGTCCGCATCTTTAGGATCTATCAGCCTTCGAGCGTCGTC
TTCGATGAGGTCCATTTCGGAGGCTTCGCCTCAAAGTACATCAAGGGAAAGTTCTTCATGGACGTACACCCGCCT
CTCGCCAAGATGCTCATCGCCCTCACCGGCTGGCTCGCTGGCTTCGACGGCAACTTCGACTTCAAGGACATTGGA
AAGGACTACCTCGAGCCCGGCGTGCCCTACGTGGCCATGCGAATGTTCCCGGCTGTGTGTGGCATCGCTTTGGCC
CCCTTTATGTTCCTCACCCTCAAGGCCATCGGATCCCGTACAATGACGGCTGCCATGGGCGCTTGTCTCATCATA
TTTGAAAACGGTCTTTTGACCCAGGCCCGTCTGATACTCCTCGACTCTCCTCTTGTCGCCGCCACGGCCTTTACT
GTGCTCGCCTTCACCTGCTTCACCAATCAGCACGAGCAGGGCCCTGCCAAGGCCTTTAAGCCCGCCTGGTGGTTC
TGGCTGGCAATGACTGGTCTCGGTCTCGGGACCACCGTCAGCATCAAATGGGTCGGCCTCTTCACCATCGCCTGG
GTTGGTATTCTGACCCTGGTCCAACTATGGGTGCTGCTCGGAGACAATCGAAACGTCACTCTGCGACTCTGGACG
AAGCATTTTATGGCTAGAATCTTCTGTCTCGTCATCATCCCCGTCACCTTCTACCTCGCCATGTTCGCCATCCAC
TTCGTCTGCCTTGTAAACCCCGGTGACGGCGATGGCTTCATGAGCTCCGAGTTTCAGGCGACGCTCAACAGCAAG
GGCATGAAGGACGTGGCGGCCGACGTGGTTCTGGGCAGCCGCATCACCATGCGTCACGTCAACACTCAGGGCGGT
TACCTCCATTCCCATCCGCTCATGTACCCGACCGGCAGCAAGCAGCAGCAGATCACGCTGTATCCGCACAAAGAC
GAGAATAACGTCTGGCTCATCGAGAACCAGACGCAGCCGCTGGGGTCCGATGGCCAACCCATCAATGGCACGTTT
GCTTGGGATCAGCTCTCCGATGGCCCGCGCTACGTCACCAATGGCATGGTCATCCGGCTCTACCACCAGCCGACG
CACAGGCGACTGCACTCTCACGATGTGCGGCCACCCATCACCGAGGCTGAGTGGCAGAACGAGGTGTCGGCCTAC
GGCTTCGACGGATTCGAGGGCGATGCCAACGATCTGTTCCGCGTCGAGATTGTCAAGAAGAAGTCGTCGGGCGCC
GTGGCCAAGGAGAGGCTCCGCACCATCGAGACCAAGTTCAGGCTCGTCCACATCATGTCCGGTTGCGTCCTCTTC
TCCCACAAGGTCAAGCTCCCCGACTGGGCCTCGGAGCAGCAGGAGGTGACGTGCGCCCGTAGCGGGTCGTTGCCC
AACAGCCTGTGGTATGTGGAGTACAACGAGCACCCGCAGCTGGGCGAGGGAGTCGAAAAGGTCAACTATCGCAAC
CCGGGCTTCCTCGGCAAGTTCTGGGAGCTCCAGCAGGTCATGTGGCGCACCAACGCCGGTCTGGTCGAGTCTCAC
GCCTGGGATTCGCGACCCGGCTCGTGGCCGATTCTGCGACGCGGCATCAACTTCTGGGGCAAGCACCATACGCAG
ATCTATCTCATCGGCAACCCCATCGTCTGGTGGTCGTCGACGCTGGCTGTCGTCGTCTGGGTCATGTTCAAGGCC
ATCGCCGTCCTCCGGTGGCAGCGCAGTTGCAACGACTATTCGAGCGCCACCTTTAAACGCTTCGACTACGAGATC
GGTACCTACGTGCTTGGCTGGATGCTGCACTATTTCCCCTTTTACCTGATGCAGCGCCAGCTCTTCCTACATCAC
TACTTCCCGGCCTTGTACTTTGCCGTCGTCGCCCTCTGCCAGATGTTTGACTATCTCACCGTTCGCATCCCCGGC
GTCGGGGCCCGGGACGGGGCTGTCGTCAACAAGGCGGCCACCGTCTGCTTCCTCGTGCTGTCTGCCGCTGCCTTT
ACCCTCTACGCCCCTCTGGCCTACGGGAATCACTGGACAAAGAGCGAGTGTAGCCGGGTCAAGGTTCTCGGCACG
TGGGACTGGGACTGCAACAACTTTTACGATTCGTATGAGGCCTACTCGTCCGAGGGCTCCCTCGCCAGCCCGCCC
GCGGCCTCCACGACGGCGGCCAAGAAGTCTGTCGAAAAGGTGGCAGCCGAAATATCGTCGCCCTCGCCGCCGCCC
GGTCCCCGCGTTGTATCTCTGGAAGAGTCGGTCGAGTACCGCGATCAGGACGGCAACCTCCTCAACGCGGAGCAG
GTCGAAAAGCTCAAGGGCAAGGTCGACTTCCAGACGCACTACGAGACGCGCACCCGCGTCCTCGACGAGCAGGGC
AATGAACTCCCCATGCCGGAGGGTGGCTGGCCCGCTGACCTCGACGCCGGCGTCGCGCCCCCTCATCCCGACGTG
GAGGGCGTCGACAAGGAGACGGTCAAGGCAGGCGGTGCCGAACCGCCCAGGCACGCGGCGGCTAGTCGTGATGGC
GAGAGGGAGGCTGAGTGGGCGAAGGCTAAGCCTGGGAGTGAGGGGAAGGATGCGACGGTTAGGGATGAGCTTTAG
Transcript >Ophun1|3924
ATGGCCAAGTCCACCGCCAGCGGCGGCAAAAGCCCTCCGCCGCCGGACCGCTCCTCTCCGACACCGAGAGCCAAG
GCCAAGAAGATCGCCTCGTACCAGTCGGACGGAGTCGAGGACCACGATGTCTTCCTGTTGCCCGTGTCCGACTAC
GTCGTCACTCTCTGCGTCACCGTCCTGGCCACCGTCGTCCGCATCTTTAGGATCTATCAGCCTTCGAGCGTCGTC
TTCGATGAGGTCCATTTCGGAGGCTTCGCCTCAAAGTACATCAAGGGAAAGTTCTTCATGGACGTACACCCGCCT
CTCGCCAAGATGCTCATCGCCCTCACCGGCTGGCTCGCTGGCTTCGACGGCAACTTCGACTTCAAGGACATTGGA
AAGGACTACCTCGAGCCCGGCGTGCCCTACGTGGCCATGCGAATGTTCCCGGCTGTGTGTGGCATCGCTTTGGCC
CCCTTTATGTTCCTCACCCTCAAGGCCATCGGATCCCGTACAATGACGGCTGCCATGGGCGCTTGTCTCATCATA
TTTGAAAACGGTCTTTTGACCCAGGCCCGTCTGATACTCCTCGACTCTCCTCTTGTCGCCGCCACGGCCTTTACT
GTGCTCGCCTTCACCTGCTTCACCAATCAGCACGAGCAGGGCCCTGCCAAGGCCTTTAAGCCCGCCTGGTGGTTC
TGGCTGGCAATGACTGGTCTCGGTCTCGGGACCACCGTCAGCATCAAATGGGTCGGCCTCTTCACCATCGCCTGG
GTTGGTATTCTGACCCTGGTCCAACTATGGGTGCTGCTCGGAGACAATCGAAACGTCACTCTGCGACTCTGGACG
AAGCATTTTATGGCTAGAATCTTCTGTCTCGTCATCATCCCCGTCACCTTCTACCTCGCCATGTTCGCCATCCAC
TTCGTCTGCCTTGTAAACCCCGGTGACGGCGATGGCTTCATGAGCTCCGAGTTTCAGGCGACGCTCAACAGCAAG
GGCATGAAGGACGTGGCGGCCGACGTGGTTCTGGGCAGCCGCATCACCATGCGTCACGTCAACACTCAGGGCGGT
TACCTCCATTCCCATCCGCTCATGTACCCGACCGGCAGCAAGCAGCAGCAGATCACGCTGTATCCGCACAAAGAC
GAGAATAACGTCTGGCTCATCGAGAACCAGACGCAGCCGCTGGGGTCCGATGGCCAACCCATCAATGGCACGTTT
GCTTGGGATCAGCTCTCCGATGGCCCGCGCTACGTCACCAATGGCATGGTCATCCGGCTCTACCACCAGCCGACG
CACAGGCGACTGCACTCTCACGATGTGCGGCCACCCATCACCGAGGCTGAGTGGCAGAACGAGGTGTCGGCCTAC
GGCTTCGACGGATTCGAGGGCGATGCCAACGATCTGTTCCGCGTCGAGATTGTCAAGAAGAAGTCGTCGGGCGCC
GTGGCCAAGGAGAGGCTCCGCACCATCGAGACCAAGTTCAGGCTCGTCCACATCATGTCCGGTTGCGTCCTCTTC
TCCCACAAGGTCAAGCTCCCCGACTGGGCCTCGGAGCAGCAGGAGGTGACGTGCGCCCGTAGCGGGTCGTTGCCC
AACAGCCTGTGGTATGTGGAGTACAACGAGCACCCGCAGCTGGGCGAGGGAGTCGAAAAGGTCAACTATCGCAAC
CCGGGCTTCCTCGGCAAGTTCTGGGAGCTCCAGCAGGTCATGTGGCGCACCAACGCCGGTCTGGTCGAGTCTCAC
GCCTGGGATTCGCGACCCGGCTCGTGGCCGATTCTGCGACGCGGCATCAACTTCTGGGGCAAGCACCATACGCAG
ATCTATCTCATCGGCAACCCCATCGTCTGGTGGTCGTCGACGCTGGCTGTCGTCGTCTGGGTCATGTTCAAGGCC
ATCGCCGTCCTCCGGTGGCAGCGCAGTTGCAACGACTATTCGAGCGCCACCTTTAAACGCTTCGACTACGAGATC
GGTACCTACGTGCTTGGCTGGATGCTGCACTATTTCCCCTTTTACCTGATGCAGCGCCAGCTCTTCCTACATCAC
TACTTCCCGGCCTTGTACTTTGCCGTCGTCGCCCTCTGCCAGATGTTTGACTATCTCACCGTTCGCATCCCCGGC
GTCGGGGCCCGGGACGGGGCTGTCGTCAACAAGGCGGCCACCGTCTGCTTCCTCGTGCTGTCTGCCGCTGCCTTT
ACCCTCTACGCCCCTCTGGCCTACGGGAATCACTGGACAAAGAGCGAGTGTAGCCGGGTCAAGGTTCTCGGCACG
TGGGACTGGGACTGCAACAACTTTTACGATTCGTATGAGGCCTACTCGTCCGAGGGCTCCCTCGCCAGCCCGCCC
GCGGCCTCCACGACGGCGGCCAAGAAGTCTGTCGAAAAGGTGGCAGCCGAAATATCGTCGCCCTCGCCGCCGCCC
GGTCCCCGCGTTGTATCTCTGGAAGAGTCGGTCGAGTACCGCGATCAGGACGGCAACCTCCTCAACGCGGAGCAG
GTCGAAAAGCTCAAGGGCAAGGTCGACTTCCAGACGCACTACGAGACGCGCACCCGCGTCCTCGACGAGCAGGGC
AATGAACTCCCCATGCCGGAGGGTGGCTGGCCCGCTGACCTCGACGCCGGCGTCGCGCCCCCTCATCCCGACGTG
GAGGGCGTCGACAAGGAGACGGTCAAGGCAGGCGGTGCCGAACCGCCCAGGCACGCGGCGGCTAGTCGTGATGGC
GAGAGGGAGGCTGAGTGGGCGAAGGCTAAGCCTGGGAGTGAGGGGAAGGATGCGACGGTTAGGGATGAGCTTTAG
Gene >Ophun1|3924
ATGGCCAAGTCCACCGCCAGCGGCGGCAAAAGCCCTCCGCCGCCGGACCGCTCCTCTCCGACACCGAGAGCCAAG
GCCAAGAAGATCGCCTCGTACCAGTCGGACGGAGTCGAGGACCACGATGTCTTCCTGTTGCCCGTGTCCGACTAC
GTCGTCACTCTCTGCGTCACCGTCCTGGCCACCGTCGTCCGCATCTTTAGGATCTATCAGCCTTCGAGCGTCGTC
TTCGATGAGGTCCAGTGCGTACGATTGCTCCCCTTGGCCCTTTGTCTCTGACCGCGTCGCAGTTTCGGAGGCTTC
GCCTCAAAGTACATCAAGGGAAAGTTCTTCATGGACGTACACCCGCCTCTCGCCAAGATGCTCATCGCCCTCACC
GGCTGGCTCGCTGGCTTCGACGGCAACTTCGACTTCAAGGACATTGGAAAGGACTACCTCGAGCCCGGCGTGCCC
TACGTGGCCATGCGAATGTTCCCGGCTGTGTGTGGCATCGCTTTGGCCCCCTTTATGTTCCTCACCCTCAAGGCC
ATCGGATCCCGTACAATGACGGCTGCCATGGGCGCTTGTCTCATCATATTTGGTGTGTTTCGTGCCGATAATGAC
AGAGATGTTGTCTAATAGCAAGTATGCAGAAAACGGTCTTTTGACCCAGGCCCGTCTGATACTCCTCGACTCTCC
TCTTGTCGCCGCCACGGCCTTTACTGTGCTCGCCTTCACCTGCTTCACCAATCAGCACGAGCAGGGCCCTGCCAA
GGCCTTTAAGCCCGCCTGGTGGTTCTGGCTGGCAATGACTGGTCTCGGTCTCGGGACCACCGTCAGCATCAAATG
GGTCGGCCTCTTCACCATCGCCTGGGTTGGTATTCTGACCCTGGTCCAACTATGGGTGCTGCTCGGAGACAATCG
AAACGTCACTCTGGTAAGTTGATATCATTCCTTATCTTCTCTGTGATGCCGGTCTAACGTGTTGGCAGCGACTCT
GGACGAAGCATTTTATGGCTAGAATCTTCTGTCTCGTCATCATCCCCGTCACCTTCTACCTCGCCATGTTCGCCA
TCCACTTCGTCTGCCTTGTAAACCCCGGTGACGGCGATGGCTTCATGAGCTCCGAGTTTCAGGCGACGCTCAACA
GCAAGGGCATGAAGGACGTGGCGGCCGACGTGGTTCTGGGCAGCCGCATCACCATGCGTCACGTCAACACTCAGG
GCGGTTACCTCCATTCCCATCCGCTCATGTACCCGACCGGCAGCAAGCAGCAGCAGATCACGCTGTATCCGCACA
AAGACGAGAATAACGTCTGGCTCATCGAGAACCAGACGCAGCCGCTGGGGTCCGATGGCCAACCCATCAATGGCA
CGTTTGCTTGGGATCAGCTCTCCGATGGCCCGCGCTACGTCACCAATGGCATGGTCATCCGGCTCTACCACCAGC
CGACGCACAGGCGACTGCACTCTCACGATGTGCGGCCACCCATCACCGAGGCTGAGTGGCAGAACGAGGTGTCGG
CCTACGGCTTCGACGGATTCGAGGGCGATGCCAACGATCTGTTCCGCGTCGAGATTGTCAAGAAGAAGTCGTCGG
GCGCCGTGGCCAAGGAGAGGCTCCGCACCATCGAGACCAAGTTCAGGCTCGTCCACATCATGTCCGGTTGCGTCC
TCTTCTCCCACAAGGTCAAGCTCCCCGACTGGGCCTCGGAGCAGCAGGAGGTGACGTGCGCCCGTAGCGGGTCGT
TGCCCAACAGCCTGTGGTATGTGGAGTACAACGAGCACCCGCAGCTGGGCGAGGGAGTCGAAAAGGTCAACTATC
GCAACCCGGGCTTCCTCGGCAAGTTCTGGGAGCTCCAGCAGGTCATGTGGCGCACCAACGCCGGTCTGGTCGAGT
CTCACGCCTGGGATTCGCGACCCGGCTCGTGGCCGATTCTGCGACGCGGCATCAACTTCTGGGGCAAGCACCATA
CGCAGATCTATCTCATCGGCAACCCCATCGTCTGGTGGTCGTCGACGCTGGCTGTCGTCGTCTGGGTCATGTTCA
AGGCCATCGCCGTCCTCCGGTGGCAGCGCAGTTGCAACGACTATTCGAGCGCCACCTTTAAACGCTTCGACTACG
AGATCGGTACCTACGTGCTTGGCTGGATGCTGCACTATTTCCCCTTTTACCTGATGCAGCGCCAGCTCTTCCTAC
ATCACTACTTCCCGGCCTTGTACTTTGCCGTCGTCGCCCTCTGCCAGATGTTTGACTATCTCACCGTTCGCATCC
CCGGCGTCGGGGCCCGGGACGGGGCTGTCGTCAACAAGGCGGCCACCGTCTGCTTCCTCGTGCTGTCTGCCGCTG
CCTTTACCCTCTACGCCCCTCTGGCCTACGGGAATCACTGGACAAAGAGCGAGTGTAGCCGGGTCAAGGTTCTCG
GCACGTGGGACTGGGACTGCAACAACTTTTACGATTCGGTGAGTACTGAGAGCTCGCCCTTTGACTGTCGCGCTG
ACATCTGTTTAGTATGAGGCCTACTCGTCCGAGGGCTCCCTCGCCAGCCCGCCCGCGGCCTCCACGACGGCGGCC
AAGAAGTCTGTCGAAAAGGTGGCAGCCGAAATATCGTCGCCCTCGCCGCCGCCCGGTCCCCGCGTTGTATCTCTG
GAAGAGTCGGTCGAGTACCGCGATCAGGACGGCAACCTCCTCAACGCGGAGCAGGTCGAAAAGCTCAAGGGCAAG
GTCGACTTCCAGACGCACTACGAGACGCGCACCCGCGTCCTCGACGAGCAGGGCAATGAACTCCCCATGCCGGAG
GGTGGCTGGCCCGCTGACCTCGACGCCGGCGTCGCGCCCCCTCATCCCGACGTGGAGGGCGTCGACAAGGAGACG
GTCAAGGCAGGCGGTGCCGAACCGCCCAGGCACGCGGCGGCTAGTCGTGATGGCGAGAGGGAGGCTGAGTGGGCG
AAGGCTAAGCCTGGGAGTGAGGGGAAGGATGCGACGGTTAGGGATGAGCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail