Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3923
Gene name
LocationContig_355:9770..11622
Strand-
Gene length (bp)1852
Transcript length (bp)1623
Coding sequence length (bp)1623
Protein length (aa) 541

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12230 PRP21_like_P Pre-mRNA splicing factor PRP21 like protein 2.8E-51 230 481
PF01805 Surp Surp module 4.0E-19 57 107
PF01805 Surp Surp module 5.8E-14 154 204

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13900|SA114_SCHPO Pre-mRNA-splicing factor sap114 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap114 PE=1 SV=1 46 513 2.0E-75
sp|Q8RXF1|SF3A1_ARATH Probable splicing factor 3A subunit 1 OS=Arabidopsis thaliana GN=At1g14650 PE=1 SV=2 48 486 9.0E-52
sp|Q15459|SF3A1_HUMAN Splicing factor 3A subunit 1 OS=Homo sapiens GN=SF3A1 PE=1 SV=1 48 300 2.0E-50
sp|Q8K4Z5|SF3A1_MOUSE Splicing factor 3A subunit 1 OS=Mus musculus GN=Sf3a1 PE=1 SV=1 44 300 7.0E-50
sp|A2VDN6|SF3A1_BOVIN Splicing factor 3A subunit 1 OS=Bos taurus GN=SF3A1 PE=2 SV=1 48 300 7.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13900|SA114_SCHPO Pre-mRNA-splicing factor sap114 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap114 PE=1 SV=1 46 513 2.0E-75
sp|Q8RXF1|SF3A1_ARATH Probable splicing factor 3A subunit 1 OS=Arabidopsis thaliana GN=At1g14650 PE=1 SV=2 48 486 9.0E-52
sp|Q15459|SF3A1_HUMAN Splicing factor 3A subunit 1 OS=Homo sapiens GN=SF3A1 PE=1 SV=1 48 300 2.0E-50
sp|Q8K4Z5|SF3A1_MOUSE Splicing factor 3A subunit 1 OS=Mus musculus GN=Sf3a1 PE=1 SV=1 44 300 7.0E-50
sp|A2VDN6|SF3A1_BOVIN Splicing factor 3A subunit 1 OS=Bos taurus GN=SF3A1 PE=2 SV=1 48 300 7.0E-50
sp|Q86A14|SF3A1_DICDI Probable splicing factor 3A subunit 1 OS=Dictyostelium discoideum GN=sf3a1 PE=3 SV=1 152 300 7.0E-18
sp|P32524|PRP21_YEAST Pre-mRNA-splicing factor PRP21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP21 PE=1 SV=1 51 277 3.0E-09
sp|Q86A14|SF3A1_DICDI Probable splicing factor 3A subunit 1 OS=Dictyostelium discoideum GN=sf3a1 PE=3 SV=1 55 110 1.0E-06
sp|Q12872|SFSWA_HUMAN Splicing factor, suppressor of white-apricot homolog OS=Homo sapiens GN=SFSWAP PE=1 SV=3 42 123 5.0E-06
sp|Q8IWX8|CHERP_HUMAN Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens GN=CHERP PE=1 SV=3 51 106 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006396 RNA processing Yes
GO:0003723 RNA binding Yes
GO:0090304 nucleic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0003676 nucleic acid binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016070 RNA metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1736
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4245
Ophiocordyceps australis map64 (Brazil) OphauB2|732
Ophiocordyceps camponoti-floridani Ophcf2|03019
Ophiocordyceps camponoti-rufipedis Ophun1|3923 (this protein)
Ophiocordyceps kimflemingae Ophio5|2681
Ophiocordyceps subramaniannii Hirsu2|1593

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3923
MTPSEELARNKPSIEARTLHRPRSSMAAAPTANGDASGALDNLQPPPNVVLPPRDLRTVLEKTAGYVARNGAVFE
DRIRDKESRNPKFSFLSPSDAYYNFYQWRLSEIKAGRGTDIAAGRAGEVPKPEKPKGPPAPPELHYSAKMPRINQ
KDMDVLKLTAQFTAKFGRQWMTQLAQREAGNPQFQFLIPNHTFHNFFQHVVEQYSKVLKHHETSKLREEMLSEAR
SNRAKQYRVLDRAKQRAEYAKYQETEKQKKEEEDTKKKEDFARVDWSDFVVVETITFTDADETANLPPPTSLSEL
EYASLEDRNKASISANFRIEEAMPGEDMEMHEQAHMLPPRLVSMPQQTAPNNQPAQFPAPEQKSAERQAMEAEEA
RRIQERAEAQARMQQAQAEARGGAAPMKIKENYVPRAAQRAASKVQMALCPNCKQQIPMNELDEHMRIELLDPSW
KEQKAKADSRYAHSNISHADVANNLKRLASQRSDVFDPITGQAVSEDELARRKKTALPSFDGSPEAKSQMQSFNV
EEQIKAIHQKFADKK*
Coding >Ophun1|3923
ATGACTCCATCTGAAGAATTGGCCAGGAATAAGCCGTCGATCGAAGCGCGCACGCTTCATCGGCCACGGTCCAGC
ATGGCAGCAGCTCCCACGGCGAACGGCGATGCGTCCGGTGCGCTGGACAATCTCCAGCCTCCGCCAAACGTCGTC
TTACCGCCGCGCGACCTCCGTACCGTCCTCGAGAAGACGGCTGGCTACGTGGCTCGGAACGGCGCTGTTTTCGAG
GACCGCATCCGCGACAAGGAAAGCCGAAATCCCAAGTTTAGCTTCCTCTCCCCGTCCGACGCCTACTACAACTTC
TATCAATGGCGGCTCAGCGAGATCAAGGCCGGCCGCGGCACCGACATCGCCGCTGGCCGGGCTGGCGAGGTGCCC
AAGCCCGAGAAGCCCAAGGGACCACCGGCTCCGCCCGAGCTGCACTATTCGGCCAAGATGCCGCGCATCAACCAG
AAAGACATGGACGTTCTCAAGCTCACGGCGCAGTTTACGGCCAAGTTTGGGCGCCAGTGGATGACGCAGCTGGCC
CAGCGTGAGGCGGGCAACCCGCAGTTCCAGTTCCTCATCCCCAATCACACCTTTCACAATTTCTTCCAGCATGTG
GTGGAGCAGTATTCCAAGGTGCTCAAGCATCACGAAACCTCGAAGCTACGAGAGGAAATGCTCTCCGAGGCGCGC
AGCAACCGTGCCAAGCAGTACCGCGTCCTCGACCGGGCCAAGCAGCGAGCCGAATACGCCAAGTACCAGGAGACG
GAGAAGCAGAAGAAGGAAGAAGAAGACACTAAGAAGAAGGAAGATTTTGCGCGTGTCGACTGGAGCGACTTCGTC
GTCGTCGAGACCATCACCTTTACCGACGCCGACGAGACGGCCAACCTGCCGCCGCCAACCAGCCTGTCGGAGCTC
GAGTACGCGTCTCTAGAGGACAGGAATAAGGCGTCCATCAGCGCCAACTTTCGCATCGAGGAGGCTATGCCCGGC
GAAGACATGGAGATGCACGAACAGGCCCATATGCTTCCGCCGCGTCTCGTATCCATGCCGCAGCAGACGGCGCCG
AACAATCAGCCGGCCCAGTTCCCGGCTCCGGAGCAGAAATCGGCGGAGAGGCAGGCCATGGAGGCGGAGGAGGCG
CGGCGCATTCAGGAGAGAGCAGAAGCGCAGGCTCGGATGCAGCAAGCGCAGGCGGAAGCCAGAGGCGGCGCAGCA
CCGATGAAGATTAAAGAAAACTACGTTCCCCGGGCGGCGCAGCGGGCAGCAAGCAAGGTTCAGATGGCACTCTGT
CCGAACTGCAAGCAGCAAATACCGATGAACGAGTTGGACGAGCACATGCGAATCGAGCTTCTGGATCCCAGCTGG
AAGGAACAAAAGGCCAAGGCAGATTCTCGCTACGCACACTCCAACATCTCCCACGCCGACGTGGCCAACAACCTC
AAGAGGCTCGCCAGCCAACGCAGCGACGTCTTCGACCCCATCACAGGCCAAGCCGTCAGCGAAGACGAGCTCGCC
CGACGCAAGAAGACGGCACTACCCAGCTTCGACGGCAGCCCCGAGGCCAAGAGCCAGATGCAGAGCTTCAATGTG
GAGGAGCAGATCAAGGCGATCCACCAAAAGTTTGCGGACAAGAAGTGA
Transcript >Ophun1|3923
ATGACTCCATCTGAAGAATTGGCCAGGAATAAGCCGTCGATCGAAGCGCGCACGCTTCATCGGCCACGGTCCAGC
ATGGCAGCAGCTCCCACGGCGAACGGCGATGCGTCCGGTGCGCTGGACAATCTCCAGCCTCCGCCAAACGTCGTC
TTACCGCCGCGCGACCTCCGTACCGTCCTCGAGAAGACGGCTGGCTACGTGGCTCGGAACGGCGCTGTTTTCGAG
GACCGCATCCGCGACAAGGAAAGCCGAAATCCCAAGTTTAGCTTCCTCTCCCCGTCCGACGCCTACTACAACTTC
TATCAATGGCGGCTCAGCGAGATCAAGGCCGGCCGCGGCACCGACATCGCCGCTGGCCGGGCTGGCGAGGTGCCC
AAGCCCGAGAAGCCCAAGGGACCACCGGCTCCGCCCGAGCTGCACTATTCGGCCAAGATGCCGCGCATCAACCAG
AAAGACATGGACGTTCTCAAGCTCACGGCGCAGTTTACGGCCAAGTTTGGGCGCCAGTGGATGACGCAGCTGGCC
CAGCGTGAGGCGGGCAACCCGCAGTTCCAGTTCCTCATCCCCAATCACACCTTTCACAATTTCTTCCAGCATGTG
GTGGAGCAGTATTCCAAGGTGCTCAAGCATCACGAAACCTCGAAGCTACGAGAGGAAATGCTCTCCGAGGCGCGC
AGCAACCGTGCCAAGCAGTACCGCGTCCTCGACCGGGCCAAGCAGCGAGCCGAATACGCCAAGTACCAGGAGACG
GAGAAGCAGAAGAAGGAAGAAGAAGACACTAAGAAGAAGGAAGATTTTGCGCGTGTCGACTGGAGCGACTTCGTC
GTCGTCGAGACCATCACCTTTACCGACGCCGACGAGACGGCCAACCTGCCGCCGCCAACCAGCCTGTCGGAGCTC
GAGTACGCGTCTCTAGAGGACAGGAATAAGGCGTCCATCAGCGCCAACTTTCGCATCGAGGAGGCTATGCCCGGC
GAAGACATGGAGATGCACGAACAGGCCCATATGCTTCCGCCGCGTCTCGTATCCATGCCGCAGCAGACGGCGCCG
AACAATCAGCCGGCCCAGTTCCCGGCTCCGGAGCAGAAATCGGCGGAGAGGCAGGCCATGGAGGCGGAGGAGGCG
CGGCGCATTCAGGAGAGAGCAGAAGCGCAGGCTCGGATGCAGCAAGCGCAGGCGGAAGCCAGAGGCGGCGCAGCA
CCGATGAAGATTAAAGAAAACTACGTTCCCCGGGCGGCGCAGCGGGCAGCAAGCAAGGTTCAGATGGCACTCTGT
CCGAACTGCAAGCAGCAAATACCGATGAACGAGTTGGACGAGCACATGCGAATCGAGCTTCTGGATCCCAGCTGG
AAGGAACAAAAGGCCAAGGCAGATTCTCGCTACGCACACTCCAACATCTCCCACGCCGACGTGGCCAACAACCTC
AAGAGGCTCGCCAGCCAACGCAGCGACGTCTTCGACCCCATCACAGGCCAAGCCGTCAGCGAAGACGAGCTCGCC
CGACGCAAGAAGACGGCACTACCCAGCTTCGACGGCAGCCCCGAGGCCAAGAGCCAGATGCAGAGCTTCAATGTG
GAGGAGCAGATCAAGGCGATCCACCAAAAGTTTGCGGACAAGAAGTGA
Gene >Ophun1|3923
ATGACTCCATCTGAAGAATTGGCCAGGAATAAGCCGTCGGTGATTTTCTAGTGTCGAATCCAGCCTCCATCGTGA
TGCACATCCATCCTCCTTAATCGTACATACACGTCACAGGCCGGAGCCTTGCATGGCCCGGAGCGCACCAACGTA
AATCCGAGCAAGCAAAACCTCCAAGGCTGAATTTCTCGAGCCAGATCGAAGCGCGCACGCTTCATCGGCCACGGT
CCAGCATGGCAGCAGCTCCCACGGCGAACGGCGATGCGTCCGGTGCGCTGGACAATCTCCAGCCTCCGCCAAACG
TCGTCTTACCGCCGCGCGACCTCCGTACCGTCCTCGAGAAGACGGCTGGCTACGTGGCTCGGAACGGCGCTGTTT
TCGAGGACCGCATCCGCGACAAGGAAAGCCGAAATCCCAAGTTTAGCTTCCTCTCCCCGTCCGACGCCTACTACA
ACTTCTATCAATGGCGGCTCAGCGAGATCAAGGCCGGCCGCGGCACCGACATCGCCGCTGGCCGGGCTGGCGAGG
TGCCCAAGCCCGAGAAGCCCAAGGGACCACCGGCTCCGCCCGAGCTGCACTATTCGGCCAAGATGCCGCGCATCA
ACCAGAAAGACATGGACGTTCTCAAGCTCACGGCGCAGTTTACGGCCAAGTTTGGGCGCCAGTGGATGACGCAGC
TGGCCCAGCGTGAGGCGGGCAACCCGCAGTTCCAGTTCCTCATCCCCAATCACACCTTTCACAATTTCTTCCAGC
ATGTGGTGGAGCAGTATTCCAAGGTGCTCAAGCATCACGAAACCTCGAAGCTACGAGAGGAAATGCTCTCCGAGG
CGCGCAGCAACCGTGCCAAGCAGTACCGCGTCCTCGACCGGGCCAAGCAGCGAGCCGAATACGCCAAGTACCAGG
AGACGGAGAAGCAGAAGAAGGAAGAAGAAGACACTAAGAAGAAGGAAGATTTTGCGCGTGTCGACTGGAGCGACT
TCGTCGTCGTCGAGACCATCACCTTTACCGACGCCGACGAGACGGCCAACCTGCCGCCGCCAACCAGCCTGTCGG
AGCTCGAGTACGCGTCTCTAGAGGACAGGAATAAGGCGTCCATCAGCGCCAACTTTCGCATCGAGGAGGCTATGC
CCGGCGAAGACATGGAGATGCACGAACAGGCCCATATGCTTCCGCCGCGTCTCGTATCCATGCCGCAGCAGACGG
CGCCGAACAATCAGCCGGCCCAGTTCCCGGCTCCGGAGCAGAAATCGGCGGAGAGGCAGGCCATGGAGGCGGAGG
AGGCGCGGCGCATTCAGGAGAGAGCAGAAGCGCAGGCTCGGATGCAGCAAGCGCAGGCGGAAGCCAGAGGCGGCG
CAGCACCGATGAAGATTAAAGAAAACTACGTTCCCCGGGCGGCGCAGCGGGCAGCAAGCAAGGTTCAGATGGCAC
TCTGTCCGAACTGCAAGCAGCAAATACCGATGAACGAGTTGGACGAGCACATGCGAAGTAACCACGCCCCCCCCT
CATCTCGCTCTATTCAGCGCAGTCTATGGCGAAGATGATGAGCTAACGCAAGACAGTCGAGCTTCTGGATCCCAG
CTGGAAGGAACAAAAGGCCAAGGCAGATTCTCGCTACGCACACTCCAACATCTCCCACGCCGACGTGGCCAACAA
CCTCAAGAGGCTCGCCAGCCAACGCAGCGACGTCTTCGACCCCATCACAGGCCAAGCCGTCAGCGAAGACGAGCT
CGCCCGACGCAAGAAGACGGCACTACCCAGCTTCGACGGCAGCCCCGAGGCCAAGAGCCAGATGCAGAGCTTCAA
TGTGGAGGAGCAGATCAAGGCGATCCACCAAAAGTTTGCGGACAAGAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail