Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3921
Gene name
LocationContig_355:7161..8337
Strand-
Gene length (bp)1176
Transcript length (bp)1176
Coding sequence length (bp)1176
Protein length (aa) 392

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05721 PhyH Phytanoyl-CoA dioxygenase (PhyH) 4.1E-23 80 286

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2386
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4242
Ophiocordyceps australis map64 (Brazil) OphauB2|729
Ophiocordyceps camponoti-floridani Ophcf2|03017
Ophiocordyceps camponoti-rufipedis Ophun1|3921 (this protein)
Ophiocordyceps kimflemingae Ophio5|2679
Ophiocordyceps subramaniannii Hirsu2|3353

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3921
MADQFTISLDGTRLFQPQDPPSITVLESLCSRTTNPREYPLATTIQDNIPIYNLPPFNTTNPSHLTALQNEWYRT
LLHGPGALVIKALFPDPTLLNRVTKVFTDIISQEASSSQGDHFSNTTSNTRIWNALGKHALSDPPSFVAYYSNPY
LSLLAQSWLGPCYRLTAQVNNVRPGSQAQVCHRDYHLGFMSASQCAQYPRAVHLASQFLTLQGAVAHVDMPPASG
PTRLLPYSQMLAAGYLAYRQPPFIDFFDSHHVALPLAQGDALFFNPALMHAAGENTSSTDRLANLLQISSALGKP
MEAVDAIPLVDSCWELLLSRYQEGKHHEARAVVAAVAEGYPFPTNLDRNVPRGGSLAPESEQEVLWACLGEGLEK
EVVLERLGELRRAARA*
Coding >Ophun1|3921
ATGGCAGACCAATTCACCATCAGCCTCGACGGAACCCGTCTCTTCCAACCACAAGACCCCCCGTCCATCACCGTC
CTCGAATCCCTCTGCTCACGCACCACCAACCCACGAGAATACCCGCTCGCCACCACCATCCAAGACAACATCCCC
ATCTACAACCTCCCCCCCTTCAACACAACCAATCCCTCCCACCTCACCGCACTCCAAAACGAATGGTACAGAACC
CTCCTCCACGGCCCCGGCGCCCTCGTCATCAAAGCCCTCTTCCCAGACCCAACCCTCCTCAACCGCGTAACCAAA
GTCTTCACAGACATCATCTCGCAAGAAGCATCCTCATCCCAAGGCGACCACTTCTCCAACACCACCTCCAACACG
CGAATCTGGAACGCCCTCGGAAAACACGCCCTCTCCGATCCCCCCTCCTTCGTAGCCTACTATTCAAACCCCTAC
CTCTCCCTCCTCGCCCAATCCTGGCTCGGACCATGCTACCGTCTGACCGCACAGGTCAACAACGTCCGTCCCGGC
TCCCAAGCCCAAGTCTGCCACCGCGATTACCACCTCGGCTTCATGTCCGCCTCCCAGTGCGCGCAGTACCCGCGA
GCCGTCCACCTCGCAAGCCAGTTCCTCACCCTGCAGGGGGCCGTCGCTCACGTCGACATGCCGCCCGCCTCCGGA
CCGACGCGTCTGCTGCCGTACAGCCAGATGCTGGCAGCCGGTTACCTCGCCTACCGCCAGCCCCCCTTCATCGAC
TTCTTCGACAGCCATCACGTCGCCCTCCCTCTCGCCCAAGGCGACGCCCTGTTCTTCAACCCCGCGCTCATGCAC
GCAGCCGGCGAGAACACCTCCTCAACGGACCGGCTAGCAAACCTGCTGCAGATAAGCAGCGCACTAGGGAAACCC
ATGGAGGCCGTCGACGCCATCCCCCTGGTAGACAGCTGCTGGGAACTACTCCTGAGCCGCTATCAGGAGGGGAAG
CACCACGAGGCTCGGGCCGTAGTCGCCGCCGTGGCGGAGGGATATCCGTTCCCGACCAACTTGGATAGGAACGTG
CCTCGCGGGGGCAGCTTGGCGCCTGAGTCGGAGCAGGAGGTGCTGTGGGCTTGCTTGGGGGAAGGGTTGGAGAAG
GAGGTTGTGTTGGAGAGGTTGGGGGAGCTTCGGAGGGCGGCGAGGGCTTAG
Transcript >Ophun1|3921
ATGGCAGACCAATTCACCATCAGCCTCGACGGAACCCGTCTCTTCCAACCACAAGACCCCCCGTCCATCACCGTC
CTCGAATCCCTCTGCTCACGCACCACCAACCCACGAGAATACCCGCTCGCCACCACCATCCAAGACAACATCCCC
ATCTACAACCTCCCCCCCTTCAACACAACCAATCCCTCCCACCTCACCGCACTCCAAAACGAATGGTACAGAACC
CTCCTCCACGGCCCCGGCGCCCTCGTCATCAAAGCCCTCTTCCCAGACCCAACCCTCCTCAACCGCGTAACCAAA
GTCTTCACAGACATCATCTCGCAAGAAGCATCCTCATCCCAAGGCGACCACTTCTCCAACACCACCTCCAACACG
CGAATCTGGAACGCCCTCGGAAAACACGCCCTCTCCGATCCCCCCTCCTTCGTAGCCTACTATTCAAACCCCTAC
CTCTCCCTCCTCGCCCAATCCTGGCTCGGACCATGCTACCGTCTGACCGCACAGGTCAACAACGTCCGTCCCGGC
TCCCAAGCCCAAGTCTGCCACCGCGATTACCACCTCGGCTTCATGTCCGCCTCCCAGTGCGCGCAGTACCCGCGA
GCCGTCCACCTCGCAAGCCAGTTCCTCACCCTGCAGGGGGCCGTCGCTCACGTCGACATGCCGCCCGCCTCCGGA
CCGACGCGTCTGCTGCCGTACAGCCAGATGCTGGCAGCCGGTTACCTCGCCTACCGCCAGCCCCCCTTCATCGAC
TTCTTCGACAGCCATCACGTCGCCCTCCCTCTCGCCCAAGGCGACGCCCTGTTCTTCAACCCCGCGCTCATGCAC
GCAGCCGGCGAGAACACCTCCTCAACGGACCGGCTAGCAAACCTGCTGCAGATAAGCAGCGCACTAGGGAAACCC
ATGGAGGCCGTCGACGCCATCCCCCTGGTAGACAGCTGCTGGGAACTACTCCTGAGCCGCTATCAGGAGGGGAAG
CACCACGAGGCTCGGGCCGTAGTCGCCGCCGTGGCGGAGGGATATCCGTTCCCGACCAACTTGGATAGGAACGTG
CCTCGCGGGGGCAGCTTGGCGCCTGAGTCGGAGCAGGAGGTGCTGTGGGCTTGCTTGGGGGAAGGGTTGGAGAAG
GAGGTTGTGTTGGAGAGGTTGGGGGAGCTTCGGAGGGCGGCGAGGGCTTAG
Gene >Ophun1|3921
ATGGCAGACCAATTCACCATCAGCCTCGACGGAACCCGTCTCTTCCAACCACAAGACCCCCCGTCCATCACCGTC
CTCGAATCCCTCTGCTCACGCACCACCAACCCACGAGAATACCCGCTCGCCACCACCATCCAAGACAACATCCCC
ATCTACAACCTCCCCCCCTTCAACACAACCAATCCCTCCCACCTCACCGCACTCCAAAACGAATGGTACAGAACC
CTCCTCCACGGCCCCGGCGCCCTCGTCATCAAAGCCCTCTTCCCAGACCCAACCCTCCTCAACCGCGTAACCAAA
GTCTTCACAGACATCATCTCGCAAGAAGCATCCTCATCCCAAGGCGACCACTTCTCCAACACCACCTCCAACACG
CGAATCTGGAACGCCCTCGGAAAACACGCCCTCTCCGATCCCCCCTCCTTCGTAGCCTACTATTCAAACCCCTAC
CTCTCCCTCCTCGCCCAATCCTGGCTCGGACCATGCTACCGTCTGACCGCACAGGTCAACAACGTCCGTCCCGGC
TCCCAAGCCCAAGTCTGCCACCGCGATTACCACCTCGGCTTCATGTCCGCCTCCCAGTGCGCGCAGTACCCGCGA
GCCGTCCACCTCGCAAGCCAGTTCCTCACCCTGCAGGGGGCCGTCGCTCACGTCGACATGCCGCCCGCCTCCGGA
CCGACGCGTCTGCTGCCGTACAGCCAGATGCTGGCAGCCGGTTACCTCGCCTACCGCCAGCCCCCCTTCATCGAC
TTCTTCGACAGCCATCACGTCGCCCTCCCTCTCGCCCAAGGCGACGCCCTGTTCTTCAACCCCGCGCTCATGCAC
GCAGCCGGCGAGAACACCTCCTCAACGGACCGGCTAGCAAACCTGCTGCAGATAAGCAGCGCACTAGGGAAACCC
ATGGAGGCCGTCGACGCCATCCCCCTGGTAGACAGCTGCTGGGAACTACTCCTGAGCCGCTATCAGGAGGGGAAG
CACCACGAGGCTCGGGCCGTAGTCGCCGCCGTGGCGGAGGGATATCCGTTCCCGACCAACTTGGATAGGAACGTG
CCTCGCGGGGGCAGCTTGGCGCCTGAGTCGGAGCAGGAGGTGCTGTGGGCTTGCTTGGGGGAAGGGTTGGAGAAG
GAGGTTGTGTTGGAGAGGTTGGGGGAGCTTCGGAGGGCGGCGAGGGCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail