Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3906
Gene name
LocationContig_353:230..602
Strand+
Gene length (bp)372
Transcript length (bp)372
Coding sequence length (bp)372
Protein length (aa) 124

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00534 Glycos_transf_1 Glycosyl transferases group 1 3.6E-08 4 59

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8X0H8|ALG2_NEUCR Alpha-1,3/1,6-mannosyltransferase alg-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-2 PE=3 SV=1 1 80 1.0E-16
sp|Q96WW6|ALG2_SCHPO Alpha-1,3/1,6-mannosyltransferase alg2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg2 PE=3 SV=2 1 115 1.0E-14
sp|Q6CWQ0|ALG2_KLULA Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ALG2 PE=3 SV=1 6 80 7.0E-08
sp|O94738|ALG2_RHIPU Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Rhizomucor pusillus GN=ALG2 PE=1 SV=1 1 113 9.0E-08
sp|Q7KWM5|ALG2_DICDI Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Dictyostelium discoideum GN=alg2 PE=3 SV=1 1 79 1.0E-06

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 99 121 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3906
MLAARPVLAANSGGPVETVRDGRTGWLRDPRDVDAWSDAMHQALALSDAERKAMGDEAAARVRAEFGRDVMARRL
HHLLDVAAVAAKEGAPARLASPLTFAMLIMFFLFGAVLSAACMRLFRG*
Coding >Ophun1|3906
ATGCTCGCCGCCCGCCCCGTCCTAGCCGCCAACTCAGGCGGGCCCGTCGAGACAGTCCGCGACGGCCGAACCGGC
TGGCTCCGCGACCCGCGCGACGTCGACGCCTGGTCCGACGCCATGCACCAAGCTCTCGCCCTATCGGATGCCGAG
CGTAAGGCAATGGGCGATGAGGCCGCGGCTCGCGTGCGCGCCGAATTTGGCCGTGACGTCATGGCCCGTCGCCTC
CATCATCTCCTTGATGTCGCTGCCGTGGCTGCCAAGGAGGGCGCTCCGGCTCGGCTCGCTAGTCCGCTGACGTTT
GCCATGTTGATCATGTTCTTCCTCTTCGGAGCCGTCTTGTCTGCTGCGTGTATGCGTCTGTTCAGGGGGTGA
Transcript >Ophun1|3906
ATGCTCGCCGCCCGCCCCGTCCTAGCCGCCAACTCAGGCGGGCCCGTCGAGACAGTCCGCGACGGCCGAACCGGC
TGGCTCCGCGACCCGCGCGACGTCGACGCCTGGTCCGACGCCATGCACCAAGCTCTCGCCCTATCGGATGCCGAG
CGTAAGGCAATGGGCGATGAGGCCGCGGCTCGCGTGCGCGCCGAATTTGGCCGTGACGTCATGGCCCGTCGCCTC
CATCATCTCCTTGATGTCGCTGCCGTGGCTGCCAAGGAGGGCGCTCCGGCTCGGCTCGCTAGTCCGCTGACGTTT
GCCATGTTGATCATGTTCTTCCTCTTCGGAGCCGTCTTGTCTGCTGCGTGTATGCGTCTGTTCAGGGGGTGA
Gene >Ophun1|3906
ATGCTCGCCGCCCGCCCCGTCCTAGCCGCCAACTCAGGCGGGCCCGTCGAGACAGTCCGCGACGGCCGAACCGGC
TGGCTCCGCGACCCGCGCGACGTCGACGCCTGGTCCGACGCCATGCACCAAGCTCTCGCCCTATCGGATGCCGAG
CGTAAGGCAATGGGCGATGAGGCCGCGGCTCGCGTGCGCGCCGAATTTGGCCGTGACGTCATGGCCCGTCGCCTC
CATCATCTCCTTGATGTCGCTGCCGTGGCTGCCAAGGAGGGCGCTCCGGCTCGGCTCGCTAGTCCGCTGACGTTT
GCCATGTTGATCATGTTCTTCCTCTTCGGAGCCGTCTTGTCTGCTGCGTGTATGCGTCTGTTCAGGGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail