Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3900
Gene name
LocationContig_352:1487..8921
Strand-
Gene length (bp)7434
Transcript length (bp)6975
Coding sequence length (bp)6975
Protein length (aa) 2325

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08649 DASH_Dad1 DASH complex subunit Dad1 8.8E-18 2253 2294
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 4.0E-06 1266 1307

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8QG78|NCOR1_XENLA Nuclear receptor corepressor 1 OS=Xenopus laevis GN=ncor1 PE=1 SV=1 886 1039 8.0E-12
sp|Q4KKX4|NCOR1_XENTR Nuclear receptor corepressor 1 OS=Xenopus tropicalis GN=ncor1 PE=2 SV=1 885 1039 6.0E-11
sp|Q9Y618|NCOR2_HUMAN Nuclear receptor corepressor 2 OS=Homo sapiens GN=NCOR2 PE=1 SV=2 886 1032 1.0E-10
sp|Q60974|NCOR1_MOUSE Nuclear receptor corepressor 1 OS=Mus musculus GN=Ncor1 PE=1 SV=1 885 1038 5.0E-10
sp|P25357|SNT1_YEAST Probable DNA-binding protein SNT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNT1 PE=1 SV=2 1241 1328 6.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8QG78|NCOR1_XENLA Nuclear receptor corepressor 1 OS=Xenopus laevis GN=ncor1 PE=1 SV=1 886 1039 8.0E-12
sp|Q4KKX4|NCOR1_XENTR Nuclear receptor corepressor 1 OS=Xenopus tropicalis GN=ncor1 PE=2 SV=1 885 1039 6.0E-11
sp|Q9Y618|NCOR2_HUMAN Nuclear receptor corepressor 2 OS=Homo sapiens GN=NCOR2 PE=1 SV=2 886 1032 1.0E-10
sp|Q60974|NCOR1_MOUSE Nuclear receptor corepressor 1 OS=Mus musculus GN=Ncor1 PE=1 SV=1 885 1038 5.0E-10
sp|P25357|SNT1_YEAST Probable DNA-binding protein SNT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNT1 PE=1 SV=2 1241 1328 6.0E-10
sp|O75376|NCOR1_HUMAN Nuclear receptor corepressor 1 OS=Homo sapiens GN=NCOR1 PE=1 SV=2 885 1038 6.0E-10
sp|Q9WU42|NCOR2_MOUSE Nuclear receptor corepressor 2 OS=Mus musculus GN=Ncor2 PE=1 SV=3 886 1032 2.0E-09
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 1523 1599 7.0E-09
sp|Q10369|YDBJ_SCHPO Uncharacterized protein C22E12.19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.19 PE=3 SV=2 930 1047 3.0E-07
sp|P25357|SNT1_YEAST Probable DNA-binding protein SNT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNT1 PE=1 SV=2 930 1039 4.0E-06
sp|Q9LFE0|DOT2_ARATH SART-1 family protein DOT2 OS=Arabidopsis thaliana GN=DOT2 PE=1 SV=1 1522 1625 6.0E-06
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 1517 1616 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0072686 mitotic spindle Yes
GO:0042729 DASH complex Yes
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0005819 spindle No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0043228 non-membrane-bounded organelle No
GO:0140513 nuclear protein-containing complex No
GO:0032991 protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3900
MPPPTHHDPPFRASRYSRYDSDRRSRSPRDRSPDRFDRTSQYGDGERRRSSAEARSTSSAFPQARDSFGDPLRRE
PPRGPKALVEPSGGPRGGAFGADFRGSRGRARGRPWPARDGSRDRGRDRDMDYRDRYRDERSRERDRDRERDRDW
RESRDFRTHRSPVARARSPLRDFRDRDRDRDRDRDGPSAADADRSRRDSRDGGPPSAGSTTSDPQFALSAFGRGG
GYIRGRARGGRGEWTSSERGRGRTSYDDRGDRYPRSRSQEGRWTRDRDERDRSDRYPEPDPRRDLREDRDRGDRD
LIRSKKESRPQDPPTQSREVSPPPVAPSAPAFGSVPSRSASGGDVSLSSSAVRPHSTSKANVERPVSAGHELPFS
SVGSSRSSIYDHQSIPLGPRSQQQRPSSKQWINPGLKMGPESPKMIRGQITPQQSTIPFRRPSSQTDQAEHQRPG
SSDAMPPSRVSGSEERPRSQHSAEPGEITTRSEPAFRQQRNPADRNVIFHDASDIDAPSREAGEPIRRLGPATEG
VDEQTSPMASSKRKRGRPDVLVVRFSVPPKKTVPEQVSESDDDDDMADYFDMEIKKTEEKLSNLPEPDLPREVVA
RYAAVSHGSMVQILNESEGLAKMLMTPLEESHDGKQTVDEPVASKSEMPEPEPRAPAVSPEAAEPMVVDTQMEEP
KKESDTKVDDVKIGPSGVDAPPSTDPAPAKVSDVAPVSSVAPESKAAHAKGEEASSKDRVPPEPVANGSKIPSTP
SQVADDDDDDDDETESDDEAFVDAQKIRQFMVTPPVDSLPDYSMPDWTKDKEFLASLEPDPMMNDFVTEHLRKVH
LQQVEEQSQGRKAYAENYVRYLDFTLSDDPTAVKSRDKFSLSAPSVEAGGTVTPETKPEGRGTGRRFATERDLER
VLQASMREDEERKERELRAQKEKYRSDKEAVIPDMYWSEEQRSKAQYIDQSGFVSPERLVSQWNVLPPVNNFTQE
EAELFEKRYLELPKQWGKVAEALPRRDFGTCIQYYYLMKKELNLKEKLKKQPKRRKKGGRGKQRSSALVSELGNG
EQEGEENPDTGENGERRRPRRAAAPTWGFEQPATDSENATPAGTPGRRGASTVAKTDQPEKTDGRKGRRKTAKDK
EPKAAKAAPVPATTQVPAASAPSGGRGRSRSSSRAPNTEFPTGAPPDASSARMPTAPFEQPTAVPSGIQPPFALQ
QQQQQQQQQPLAMGERPKPMVASSMSEVMTAPSLRPEPPPPHQSSMTTFNLAQPHTERKTTTQPTSYWSVSEAND
FPNLLRAFGSDWTSIAAHMGSKTAVMVKNYFVRQKDQGKAEWEGIVQEAEAKRLRGEKRPDPPQPTAGSRGRRYD
SSTTATASSSRPLAVAPGIDIPSEAIQAKMEGPPQQPRTQTFPSYGVPIAQAPAHQPLAQPAQQPLAMQQHGPPP
PPQQQQQQQQQQQQGMSPTSHPLRAPMQQPFGFVDREPPPQQQQQQQQPQPQMTHPPQRAVAVAVPDGREQRQLA
AAQPLQPTRSDAIMERQKMAMEREMEREKEREKERERMRERERERAREREERERERERERERERERERDLERERE
RERERERERERERERELLRQAERQALKTSQEADRASQRHYDPYGHRQQPGHGGVVAAGTREPLNLVRTPSQEPAR
SGSQAYPPSMQQHPAIQQHGTVQHHPSVPPPPQQQQQQQKQQKQHAPSAQQHAHPGAQQHASVQQHPPVKQHPAI
QQHPSVHHQHQHQQQPPPHMVRNLMGEPPMATSRPLSSLQHRQSSGPPVSEPYGVGPPAPAAPAAVSAAKARPPE
PRKTSNIMSLLNDDPPPATKRVSDVSASMPGSSATPPPQSLGRTPPGPAPPSQMRREPEGQYSPYGRGPSGGGPG
MPPLKPTYSNSPGPAQHLASSERDYYRQHAYARGHHGSGTSSPQASHRYPTPGQSTQAQYQTPGGYHAAYAGGQH
AASPPPQYAVHGSASRAREVPQGGRENAWPQQGHSQGHSQSHPQQGHPQQGHPQQGHPQQGHQQGHPPQGHPQQG
HPQQGHPQGHPQGHPQAAASMQQGGGWPTPSKVQGPPPPQAQPWGGQHPSTTPGPSTPAQQPWAPPQQQQQPPSQ
QHHMSMRDERVYGSSSQPPTHRYATPAPRGPDSMAPQAQPYPRYASTPGPGAPRDPREVGRSYTPGIYDTRGPPV
GYPAPDPREMQLRDGRDPRDGREVMGRGLRPHEYERHADRSYFEQQREALVGEIATVRLVSEFSSLLTFWFLLIM
SPSQSFEHVLANINKLNRSLEAVIAVGNEFSSVEALWSQFENVMGNKEGDGDEQDATKSEAQQQQQQQKGDSQS*
Coding >Ophun1|3900
ATGCCACCTCCTACTCACCACGACCCTCCCTTCAGGGCCTCTAGGTACTCAAGATACGACTCCGACCGCCGGTCA
AGATCTCCAAGGGACCGCTCGCCCGACCGCTTTGACCGCACCTCGCAGTACGGGGACGGTGAGAGGCGGCGCTCT
TCGGCCGAGGCCAGATCCACCTCTTCAGCTTTCCCGCAAGCCCGCGACTCTTTCGGCGATCCTTTGCGAAGAGAA
CCTCCCCGCGGGCCCAAGGCGCTTGTCGAGCCTTCTGGTGGCCCCAGGGGCGGCGCCTTCGGGGCCGACTTCAGA
GGCAGCAGGGGTCGCGCTCGAGGACGACCCTGGCCTGCACGGGATGGCTCGAGGGATCGCGGAAGGGATCGAGAC
ATGGACTATCGAGACCGCTACCGCGACGAGAGGAGTCGAGAACGCGATCGTGACCGCGAGAGGGATCGCGACTGG
CGAGAGTCGAGAGATTTTCGAACTCACCGCTCCCCGGTTGCTAGGGCCCGCTCGCCCCTCAGAGACTTCCGTGAC
CGTGACCGAGACCGGGATCGGGATCGCGACGGGCCATCTGCCGCCGATGCTGACCGGTCGCGCCGCGATTCTCGA
GATGGCGGGCCCCCTTCGGCCGGCTCGACGACTTCGGATCCCCAATTTGCCCTGTCTGCCTTTGGCCGTGGTGGA
GGCTACATCCGGGGTCGGGCGAGGGGCGGTCGGGGAGAGTGGACCTCGTCCGAGAGAGGCCGCGGGCGGACCTCA
TACGACGACCGTGGCGATCGCTATCCCAGAAGTCGCAGCCAAGAGGGACGCTGGACACGCGATCGAGACGAGCGA
GACCGCAGCGACAGATATCCGGAGCCAGATCCGCGCCGCGACCTTCGTGAAGACCGTGACCGCGGTGATCGAGAC
TTGATACGATCAAAAAAGGAGAGTCGCCCGCAGGATCCTCCGACACAGTCCAGAGAGGTCTCCCCCCCCCCCGTT
GCGCCGTCGGCACCGGCTTTTGGGTCTGTTCCGAGCCGCAGCGCGAGCGGCGGTGATGTTTCCCTCTCGTCAAGC
GCCGTGAGGCCTCATTCGACTTCGAAAGCCAACGTCGAACGTCCCGTTTCTGCCGGTCACGAACTACCCTTCTCT
TCAGTGGGTTCATCCCGAAGCTCCATCTATGATCATCAGTCTATCCCTCTTGGTCCTCGATCCCAGCAGCAACGT
CCTTCGAGTAAGCAGTGGATCAACCCCGGCCTCAAGATGGGCCCGGAGTCGCCCAAGATGATCAGGGGCCAAATA
ACTCCCCAGCAAAGCACGATTCCCTTCAGACGGCCAAGTTCACAAACCGATCAAGCGGAGCACCAGCGGCCCGGG
AGTAGCGATGCCATGCCGCCTTCACGAGTATCGGGCTCCGAAGAGAGGCCTCGTTCACAGCATAGTGCCGAGCCC
GGCGAGATCACCACCAGATCCGAGCCCGCTTTCCGTCAACAGCGGAATCCGGCCGATCGAAACGTGATATTCCAC
GACGCATCGGATATTGACGCACCGTCGAGAGAAGCGGGGGAGCCCATCAGACGTCTCGGGCCAGCTACCGAAGGG
GTCGACGAGCAAACCTCACCGATGGCATCGTCGAAGCGGAAACGGGGACGACCGGACGTTTTGGTTGTGCGATTC
TCCGTGCCTCCCAAGAAAACGGTGCCGGAGCAAGTATCAGAGTCCGACGACGATGACGACATGGCCGACTACTTC
GATATGGAGATCAAGAAGACGGAAGAGAAGTTGAGCAATCTGCCGGAACCGGATCTTCCTCGCGAAGTGGTGGCG
CGCTACGCAGCTGTGTCTCATGGATCGATGGTGCAGATCTTGAACGAGAGCGAGGGCCTCGCCAAGATGCTAATG
ACGCCCCTCGAAGAATCGCATGACGGCAAACAGACCGTTGACGAGCCCGTCGCATCCAAGTCCGAGATGCCGGAA
CCGGAACCGCGCGCCCCCGCCGTGTCTCCTGAAGCCGCGGAGCCGATGGTTGTCGACACGCAGATGGAAGAGCCA
AAAAAGGAGTCCGACACGAAAGTGGACGATGTCAAGATCGGCCCTTCTGGTGTCGACGCGCCACCTTCTACCGAC
CCAGCACCTGCAAAGGTCAGCGACGTCGCCCCAGTCTCGTCAGTCGCGCCTGAGTCCAAGGCGGCTCATGCCAAG
GGAGAGGAGGCATCATCAAAAGATCGCGTTCCACCAGAACCGGTCGCAAACGGTTCGAAAATTCCAAGCACGCCC
TCGCAGGTTGCCGACGACGACGATGACGATGACGACGAGACCGAGTCCGACGACGAAGCCTTCGTGGATGCTCAA
AAGATCCGCCAGTTCATGGTCACGCCACCTGTGGACAGCCTTCCAGACTACAGCATGCCAGATTGGACCAAGGAC
AAGGAGTTTCTGGCGTCGCTGGAGCCCGATCCGATGATGAACGATTTCGTGACCGAGCATCTCAGAAAAGTTCAT
CTACAGCAAGTCGAGGAGCAGAGTCAAGGCCGGAAAGCCTACGCCGAAAACTACGTCCGCTACCTCGATTTCACC
TTGTCCGACGATCCTACCGCTGTCAAGAGCAGGGACAAGTTCTCTCTCTCGGCCCCGTCTGTGGAAGCCGGCGGC
ACCGTCACGCCAGAGACAAAACCCGAGGGTCGCGGAACGGGAAGACGGTTCGCAACCGAGCGCGACCTGGAACGT
GTCCTTCAGGCTTCTATGCGCGAGGACGAGGAGAGGAAAGAGCGAGAGCTGCGAGCCCAGAAAGAAAAGTATCGC
AGCGACAAGGAGGCCGTCATTCCCGACATGTACTGGAGCGAGGAGCAGCGGAGCAAGGCTCAGTACATTGACCAG
TCGGGATTCGTTTCCCCGGAGAGGCTCGTATCCCAGTGGAATGTGCTGCCGCCCGTCAACAACTTTACCCAGGAA
GAAGCTGAGCTGTTTGAGAAGCGATACCTTGAGCTGCCCAAGCAATGGGGCAAGGTGGCCGAGGCCTTACCGAGG
CGCGACTTTGGCACGTGCATCCAATACTACTACCTGATGAAGAAGGAGCTCAACCTCAAGGAGAAGCTCAAGAAG
CAACCAAAGAGGCGCAAGAAGGGCGGAAGGGGCAAGCAGAGATCGAGCGCATTGGTATCGGAGCTTGGCAACGGC
GAACAAGAGGGCGAAGAGAACCCAGACACCGGGGAGAACGGCGAGCGGCGACGGCCGAGGCGAGCAGCCGCTCCC
ACCTGGGGCTTCGAACAGCCGGCGACGGACAGCGAGAACGCGACGCCGGCGGGGACGCCTGGTCGTCGGGGGGCC
TCGACGGTTGCGAAGACGGACCAGCCGGAGAAGACGGATGGCAGGAAGGGGAGACGGAAGACGGCCAAGGACAAG
GAGCCCAAGGCTGCCAAGGCGGCTCCAGTCCCAGCAACGACGCAGGTCCCGGCCGCGTCGGCTCCATCCGGCGGA
AGAGGACGCTCGCGTTCCAGCTCGCGAGCCCCCAATACCGAGTTCCCGACGGGCGCCCCTCCTGACGCCAGCAGT
GCCCGCATGCCAACCGCCCCTTTCGAGCAGCCGACTGCGGTGCCCTCGGGCATACAGCCGCCCTTTGCCCTGCAG
CAGCAGCAGCAGCAGCAGCAGCAGCAGCCCCTTGCCATGGGCGAGCGGCCGAAGCCTATGGTCGCCTCGTCCATG
TCCGAGGTTATGACGGCCCCTTCACTCCGCCCCGAGCCGCCTCCACCCCACCAGTCTTCGATGACCACGTTCAAC
CTCGCCCAGCCCCATACCGAACGCAAGACGACGACACAGCCAACCAGTTACTGGAGCGTATCCGAGGCCAACGAT
TTCCCCAACTTGCTACGGGCTTTTGGATCCGACTGGACATCCATTGCCGCCCACATGGGCTCGAAAACGGCTGTC
ATGGTCAAGAACTACTTTGTTCGACAGAAGGATCAAGGCAAGGCAGAGTGGGAAGGCATTGTTCAAGAAGCCGAA
GCAAAGCGGCTACGAGGCGAGAAGCGGCCCGATCCTCCACAGCCGACAGCCGGCAGCCGCGGCAGAAGATACGAT
AGCTCGACGACGGCGACTGCGAGCTCGTCAAGGCCACTCGCCGTGGCGCCGGGCATAGATATCCCCAGCGAGGCT
ATACAGGCCAAGATGGAGGGTCCGCCGCAGCAGCCACGAACGCAGACGTTCCCCAGCTACGGCGTCCCGATCGCT
CAGGCACCCGCTCACCAGCCCCTCGCCCAGCCAGCTCAGCAGCCTCTGGCCATGCAGCAGCACGGCCCGCCGCCG
CCGCCGCAGCAGCAGCAACAACAACAGCAGCAGCAGCAGCAGGGCATGTCACCGACGAGTCATCCGCTGCGGGCG
CCAATGCAGCAGCCTTTCGGGTTCGTCGACCGCGAGCCTCCTCCACAACAACAGCAGCAGCAGCAGCAGCCGCAG
CCGCAGATGACGCATCCTCCACAGAGGGCAGTTGCAGTCGCGGTTCCGGACGGGCGCGAGCAACGGCAGCTGGCC
GCCGCACAGCCTCTGCAGCCGACGCGGTCCGACGCCATCATGGAGCGGCAGAAGATGGCGATGGAGCGCGAGATG
GAACGCGAGAAGGAGCGCGAGAAGGAGCGCGAGCGGATGAGAGAGAGGGAGCGTGAGAGGGCGCGAGAGAGAGAA
GAACGGGAAAGAGAACGAGAGCGCGAGCGCGAGAGGGAACGTGAGAGGGAGCGCGACTTGGAAAGAGAACGCGAG
CGGGAGAGGGAGCGCGAGCGGGAGCGCGAGAGGGAAAGGGAAAGGGAGCTTCTGCGGCAGGCCGAGCGACAGGCC
TTGAAGACCAGCCAGGAGGCGGATCGGGCCAGCCAGCGCCATTACGATCCATACGGCCACCGCCAGCAGCCCGGG
CATGGGGGAGTCGTGGCAGCGGGCACGAGGGAGCCCCTGAATCTCGTCCGCACTCCGTCTCAGGAGCCAGCTCGA
TCTGGTTCCCAAGCCTATCCCCCGTCGATGCAGCAGCACCCTGCTATACAGCAGCACGGCACGGTCCAGCATCAC
CCTTCTGTGCCGCCGCCGCCGCAGCAGCAGCAGCAGCAGCAGAAGCAACAGAAGCAGCACGCTCCCAGTGCTCAG
CAACATGCACACCCCGGAGCGCAGCAACACGCGTCGGTTCAGCAGCATCCTCCGGTGAAGCAGCATCCCGCTATC
CAGCAGCATCCTTCTGTCCACCACCAACACCAACATCAACAGCAGCCACCTCCTCATATGGTGCGGAATCTGATG
GGCGAGCCACCCATGGCGACATCCCGCCCGCTATCGTCGCTTCAGCACAGGCAATCCTCGGGGCCGCCCGTCTCG
GAGCCGTATGGCGTTGGGCCGCCAGCTCCAGCCGCGCCGGCAGCCGTATCAGCAGCCAAAGCCCGTCCACCCGAG
CCTCGGAAGACGTCCAACATTATGTCTCTCCTCAACGACGATCCCCCCCCGGCGACCAAGCGCGTCAGCGACGTC
TCGGCCAGCATGCCTGGATCTTCGGCGACGCCCCCTCCGCAGAGCTTGGGCCGGACTCCTCCTGGGCCGGCGCCG
CCGAGCCAAATGAGGCGAGAGCCGGAAGGGCAGTATTCCCCTTACGGCCGGGGTCCATCGGGCGGCGGTCCCGGC
ATGCCGCCTCTCAAGCCGACCTACTCCAACTCGCCCGGTCCGGCGCAGCACCTGGCTTCGAGCGAGCGGGACTAT
TACAGGCAGCATGCCTACGCGCGCGGGCACCACGGAAGCGGGACCAGCTCTCCCCAGGCGTCACATCGCTACCCA
ACGCCCGGCCAGTCGACGCAGGCTCAGTATCAGACGCCCGGCGGCTACCACGCTGCCTACGCAGGCGGACAGCAC
GCCGCATCGCCGCCGCCGCAATACGCGGTGCACGGTTCGGCTTCTCGTGCTCGCGAGGTGCCTCAGGGGGGTCGT
GAGAACGCGTGGCCTCAGCAGGGCCACTCGCAGGGCCACTCGCAGAGCCACCCGCAACAGGGCCATCCGCAACAG
GGCCACCCGCAACAGGGCCACCCGCAACAGGGTCATCAGCAGGGCCACCCGCCCCAGGGTCATCCGCAACAGGGC
CACCCGCAGCAGGGCCACCCGCAGGGCCACCCGCAAGGCCACCCGCAGGCCGCAGCCAGCATGCAGCAAGGCGGC
GGATGGCCGACTCCATCCAAGGTGCAGGGACCGCCGCCGCCTCAGGCACAGCCGTGGGGGGGCCAGCATCCGTCG
ACGACGCCCGGCCCGTCGACGCCAGCACAGCAGCCCTGGGCGCCTCCGCAGCAACAGCAGCAGCCGCCTTCGCAG
CAGCACCACATGAGCATGCGGGATGAGCGCGTGTACGGCTCAAGCTCGCAGCCACCTACACACCGGTACGCGACA
CCGGCGCCGCGCGGGCCGGATTCGATGGCGCCTCAGGCACAGCCTTATCCCCGGTACGCGTCGACACCCGGGCCC
GGGGCGCCGCGAGACCCCCGGGAGGTAGGTCGGAGCTACACGCCGGGCATTTACGACACGCGCGGTCCTCCTGTT
GGATATCCGGCTCCGGACCCGAGAGAGATGCAGCTCCGTGACGGGCGGGACCCGAGAGATGGGCGTGAGGTGATG
GGAAGAGGCCTCAGGCCGCACGAGTACGAGCGTCATGCTGACAGGTCGTACTTTGAGCAGCAGCGTGAGGCCCTC
GTCGGCGAGATTGCCACCGTACGCCTCGTCTCCGAATTCTCGTCTCTTCTTACATTCTGGTTCTTGCTGATCATG
TCGCCGTCACAGAGCTTCGAGCACGTGCTCGCCAACATCAACAAGCTAAACAGGTCCCTCGAGGCTGTCATTGCC
GTCGGCAACGAGTTCTCGTCCGTCGAGGCGCTTTGGTCGCAGTTTGAAAATGTCATGGGCAACAAGGAGGGTGAT
GGCGATGAGCAGGATGCTACCAAGTCGGAGGCGCAGCAGCAGCAGCAGCAGCAGAAGGGGGACAGCCAGTCTTGA
Transcript >Ophun1|3900
ATGCCACCTCCTACTCACCACGACCCTCCCTTCAGGGCCTCTAGGTACTCAAGATACGACTCCGACCGCCGGTCA
AGATCTCCAAGGGACCGCTCGCCCGACCGCTTTGACCGCACCTCGCAGTACGGGGACGGTGAGAGGCGGCGCTCT
TCGGCCGAGGCCAGATCCACCTCTTCAGCTTTCCCGCAAGCCCGCGACTCTTTCGGCGATCCTTTGCGAAGAGAA
CCTCCCCGCGGGCCCAAGGCGCTTGTCGAGCCTTCTGGTGGCCCCAGGGGCGGCGCCTTCGGGGCCGACTTCAGA
GGCAGCAGGGGTCGCGCTCGAGGACGACCCTGGCCTGCACGGGATGGCTCGAGGGATCGCGGAAGGGATCGAGAC
ATGGACTATCGAGACCGCTACCGCGACGAGAGGAGTCGAGAACGCGATCGTGACCGCGAGAGGGATCGCGACTGG
CGAGAGTCGAGAGATTTTCGAACTCACCGCTCCCCGGTTGCTAGGGCCCGCTCGCCCCTCAGAGACTTCCGTGAC
CGTGACCGAGACCGGGATCGGGATCGCGACGGGCCATCTGCCGCCGATGCTGACCGGTCGCGCCGCGATTCTCGA
GATGGCGGGCCCCCTTCGGCCGGCTCGACGACTTCGGATCCCCAATTTGCCCTGTCTGCCTTTGGCCGTGGTGGA
GGCTACATCCGGGGTCGGGCGAGGGGCGGTCGGGGAGAGTGGACCTCGTCCGAGAGAGGCCGCGGGCGGACCTCA
TACGACGACCGTGGCGATCGCTATCCCAGAAGTCGCAGCCAAGAGGGACGCTGGACACGCGATCGAGACGAGCGA
GACCGCAGCGACAGATATCCGGAGCCAGATCCGCGCCGCGACCTTCGTGAAGACCGTGACCGCGGTGATCGAGAC
TTGATACGATCAAAAAAGGAGAGTCGCCCGCAGGATCCTCCGACACAGTCCAGAGAGGTCTCCCCCCCCCCCGTT
GCGCCGTCGGCACCGGCTTTTGGGTCTGTTCCGAGCCGCAGCGCGAGCGGCGGTGATGTTTCCCTCTCGTCAAGC
GCCGTGAGGCCTCATTCGACTTCGAAAGCCAACGTCGAACGTCCCGTTTCTGCCGGTCACGAACTACCCTTCTCT
TCAGTGGGTTCATCCCGAAGCTCCATCTATGATCATCAGTCTATCCCTCTTGGTCCTCGATCCCAGCAGCAACGT
CCTTCGAGTAAGCAGTGGATCAACCCCGGCCTCAAGATGGGCCCGGAGTCGCCCAAGATGATCAGGGGCCAAATA
ACTCCCCAGCAAAGCACGATTCCCTTCAGACGGCCAAGTTCACAAACCGATCAAGCGGAGCACCAGCGGCCCGGG
AGTAGCGATGCCATGCCGCCTTCACGAGTATCGGGCTCCGAAGAGAGGCCTCGTTCACAGCATAGTGCCGAGCCC
GGCGAGATCACCACCAGATCCGAGCCCGCTTTCCGTCAACAGCGGAATCCGGCCGATCGAAACGTGATATTCCAC
GACGCATCGGATATTGACGCACCGTCGAGAGAAGCGGGGGAGCCCATCAGACGTCTCGGGCCAGCTACCGAAGGG
GTCGACGAGCAAACCTCACCGATGGCATCGTCGAAGCGGAAACGGGGACGACCGGACGTTTTGGTTGTGCGATTC
TCCGTGCCTCCCAAGAAAACGGTGCCGGAGCAAGTATCAGAGTCCGACGACGATGACGACATGGCCGACTACTTC
GATATGGAGATCAAGAAGACGGAAGAGAAGTTGAGCAATCTGCCGGAACCGGATCTTCCTCGCGAAGTGGTGGCG
CGCTACGCAGCTGTGTCTCATGGATCGATGGTGCAGATCTTGAACGAGAGCGAGGGCCTCGCCAAGATGCTAATG
ACGCCCCTCGAAGAATCGCATGACGGCAAACAGACCGTTGACGAGCCCGTCGCATCCAAGTCCGAGATGCCGGAA
CCGGAACCGCGCGCCCCCGCCGTGTCTCCTGAAGCCGCGGAGCCGATGGTTGTCGACACGCAGATGGAAGAGCCA
AAAAAGGAGTCCGACACGAAAGTGGACGATGTCAAGATCGGCCCTTCTGGTGTCGACGCGCCACCTTCTACCGAC
CCAGCACCTGCAAAGGTCAGCGACGTCGCCCCAGTCTCGTCAGTCGCGCCTGAGTCCAAGGCGGCTCATGCCAAG
GGAGAGGAGGCATCATCAAAAGATCGCGTTCCACCAGAACCGGTCGCAAACGGTTCGAAAATTCCAAGCACGCCC
TCGCAGGTTGCCGACGACGACGATGACGATGACGACGAGACCGAGTCCGACGACGAAGCCTTCGTGGATGCTCAA
AAGATCCGCCAGTTCATGGTCACGCCACCTGTGGACAGCCTTCCAGACTACAGCATGCCAGATTGGACCAAGGAC
AAGGAGTTTCTGGCGTCGCTGGAGCCCGATCCGATGATGAACGATTTCGTGACCGAGCATCTCAGAAAAGTTCAT
CTACAGCAAGTCGAGGAGCAGAGTCAAGGCCGGAAAGCCTACGCCGAAAACTACGTCCGCTACCTCGATTTCACC
TTGTCCGACGATCCTACCGCTGTCAAGAGCAGGGACAAGTTCTCTCTCTCGGCCCCGTCTGTGGAAGCCGGCGGC
ACCGTCACGCCAGAGACAAAACCCGAGGGTCGCGGAACGGGAAGACGGTTCGCAACCGAGCGCGACCTGGAACGT
GTCCTTCAGGCTTCTATGCGCGAGGACGAGGAGAGGAAAGAGCGAGAGCTGCGAGCCCAGAAAGAAAAGTATCGC
AGCGACAAGGAGGCCGTCATTCCCGACATGTACTGGAGCGAGGAGCAGCGGAGCAAGGCTCAGTACATTGACCAG
TCGGGATTCGTTTCCCCGGAGAGGCTCGTATCCCAGTGGAATGTGCTGCCGCCCGTCAACAACTTTACCCAGGAA
GAAGCTGAGCTGTTTGAGAAGCGATACCTTGAGCTGCCCAAGCAATGGGGCAAGGTGGCCGAGGCCTTACCGAGG
CGCGACTTTGGCACGTGCATCCAATACTACTACCTGATGAAGAAGGAGCTCAACCTCAAGGAGAAGCTCAAGAAG
CAACCAAAGAGGCGCAAGAAGGGCGGAAGGGGCAAGCAGAGATCGAGCGCATTGGTATCGGAGCTTGGCAACGGC
GAACAAGAGGGCGAAGAGAACCCAGACACCGGGGAGAACGGCGAGCGGCGACGGCCGAGGCGAGCAGCCGCTCCC
ACCTGGGGCTTCGAACAGCCGGCGACGGACAGCGAGAACGCGACGCCGGCGGGGACGCCTGGTCGTCGGGGGGCC
TCGACGGTTGCGAAGACGGACCAGCCGGAGAAGACGGATGGCAGGAAGGGGAGACGGAAGACGGCCAAGGACAAG
GAGCCCAAGGCTGCCAAGGCGGCTCCAGTCCCAGCAACGACGCAGGTCCCGGCCGCGTCGGCTCCATCCGGCGGA
AGAGGACGCTCGCGTTCCAGCTCGCGAGCCCCCAATACCGAGTTCCCGACGGGCGCCCCTCCTGACGCCAGCAGT
GCCCGCATGCCAACCGCCCCTTTCGAGCAGCCGACTGCGGTGCCCTCGGGCATACAGCCGCCCTTTGCCCTGCAG
CAGCAGCAGCAGCAGCAGCAGCAGCAGCCCCTTGCCATGGGCGAGCGGCCGAAGCCTATGGTCGCCTCGTCCATG
TCCGAGGTTATGACGGCCCCTTCACTCCGCCCCGAGCCGCCTCCACCCCACCAGTCTTCGATGACCACGTTCAAC
CTCGCCCAGCCCCATACCGAACGCAAGACGACGACACAGCCAACCAGTTACTGGAGCGTATCCGAGGCCAACGAT
TTCCCCAACTTGCTACGGGCTTTTGGATCCGACTGGACATCCATTGCCGCCCACATGGGCTCGAAAACGGCTGTC
ATGGTCAAGAACTACTTTGTTCGACAGAAGGATCAAGGCAAGGCAGAGTGGGAAGGCATTGTTCAAGAAGCCGAA
GCAAAGCGGCTACGAGGCGAGAAGCGGCCCGATCCTCCACAGCCGACAGCCGGCAGCCGCGGCAGAAGATACGAT
AGCTCGACGACGGCGACTGCGAGCTCGTCAAGGCCACTCGCCGTGGCGCCGGGCATAGATATCCCCAGCGAGGCT
ATACAGGCCAAGATGGAGGGTCCGCCGCAGCAGCCACGAACGCAGACGTTCCCCAGCTACGGCGTCCCGATCGCT
CAGGCACCCGCTCACCAGCCCCTCGCCCAGCCAGCTCAGCAGCCTCTGGCCATGCAGCAGCACGGCCCGCCGCCG
CCGCCGCAGCAGCAGCAACAACAACAGCAGCAGCAGCAGCAGGGCATGTCACCGACGAGTCATCCGCTGCGGGCG
CCAATGCAGCAGCCTTTCGGGTTCGTCGACCGCGAGCCTCCTCCACAACAACAGCAGCAGCAGCAGCAGCCGCAG
CCGCAGATGACGCATCCTCCACAGAGGGCAGTTGCAGTCGCGGTTCCGGACGGGCGCGAGCAACGGCAGCTGGCC
GCCGCACAGCCTCTGCAGCCGACGCGGTCCGACGCCATCATGGAGCGGCAGAAGATGGCGATGGAGCGCGAGATG
GAACGCGAGAAGGAGCGCGAGAAGGAGCGCGAGCGGATGAGAGAGAGGGAGCGTGAGAGGGCGCGAGAGAGAGAA
GAACGGGAAAGAGAACGAGAGCGCGAGCGCGAGAGGGAACGTGAGAGGGAGCGCGACTTGGAAAGAGAACGCGAG
CGGGAGAGGGAGCGCGAGCGGGAGCGCGAGAGGGAAAGGGAAAGGGAGCTTCTGCGGCAGGCCGAGCGACAGGCC
TTGAAGACCAGCCAGGAGGCGGATCGGGCCAGCCAGCGCCATTACGATCCATACGGCCACCGCCAGCAGCCCGGG
CATGGGGGAGTCGTGGCAGCGGGCACGAGGGAGCCCCTGAATCTCGTCCGCACTCCGTCTCAGGAGCCAGCTCGA
TCTGGTTCCCAAGCCTATCCCCCGTCGATGCAGCAGCACCCTGCTATACAGCAGCACGGCACGGTCCAGCATCAC
CCTTCTGTGCCGCCGCCGCCGCAGCAGCAGCAGCAGCAGCAGAAGCAACAGAAGCAGCACGCTCCCAGTGCTCAG
CAACATGCACACCCCGGAGCGCAGCAACACGCGTCGGTTCAGCAGCATCCTCCGGTGAAGCAGCATCCCGCTATC
CAGCAGCATCCTTCTGTCCACCACCAACACCAACATCAACAGCAGCCACCTCCTCATATGGTGCGGAATCTGATG
GGCGAGCCACCCATGGCGACATCCCGCCCGCTATCGTCGCTTCAGCACAGGCAATCCTCGGGGCCGCCCGTCTCG
GAGCCGTATGGCGTTGGGCCGCCAGCTCCAGCCGCGCCGGCAGCCGTATCAGCAGCCAAAGCCCGTCCACCCGAG
CCTCGGAAGACGTCCAACATTATGTCTCTCCTCAACGACGATCCCCCCCCGGCGACCAAGCGCGTCAGCGACGTC
TCGGCCAGCATGCCTGGATCTTCGGCGACGCCCCCTCCGCAGAGCTTGGGCCGGACTCCTCCTGGGCCGGCGCCG
CCGAGCCAAATGAGGCGAGAGCCGGAAGGGCAGTATTCCCCTTACGGCCGGGGTCCATCGGGCGGCGGTCCCGGC
ATGCCGCCTCTCAAGCCGACCTACTCCAACTCGCCCGGTCCGGCGCAGCACCTGGCTTCGAGCGAGCGGGACTAT
TACAGGCAGCATGCCTACGCGCGCGGGCACCACGGAAGCGGGACCAGCTCTCCCCAGGCGTCACATCGCTACCCA
ACGCCCGGCCAGTCGACGCAGGCTCAGTATCAGACGCCCGGCGGCTACCACGCTGCCTACGCAGGCGGACAGCAC
GCCGCATCGCCGCCGCCGCAATACGCGGTGCACGGTTCGGCTTCTCGTGCTCGCGAGGTGCCTCAGGGGGGTCGT
GAGAACGCGTGGCCTCAGCAGGGCCACTCGCAGGGCCACTCGCAGAGCCACCCGCAACAGGGCCATCCGCAACAG
GGCCACCCGCAACAGGGCCACCCGCAACAGGGTCATCAGCAGGGCCACCCGCCCCAGGGTCATCCGCAACAGGGC
CACCCGCAGCAGGGCCACCCGCAGGGCCACCCGCAAGGCCACCCGCAGGCCGCAGCCAGCATGCAGCAAGGCGGC
GGATGGCCGACTCCATCCAAGGTGCAGGGACCGCCGCCGCCTCAGGCACAGCCGTGGGGGGGCCAGCATCCGTCG
ACGACGCCCGGCCCGTCGACGCCAGCACAGCAGCCCTGGGCGCCTCCGCAGCAACAGCAGCAGCCGCCTTCGCAG
CAGCACCACATGAGCATGCGGGATGAGCGCGTGTACGGCTCAAGCTCGCAGCCACCTACACACCGGTACGCGACA
CCGGCGCCGCGCGGGCCGGATTCGATGGCGCCTCAGGCACAGCCTTATCCCCGGTACGCGTCGACACCCGGGCCC
GGGGCGCCGCGAGACCCCCGGGAGGTAGGTCGGAGCTACACGCCGGGCATTTACGACACGCGCGGTCCTCCTGTT
GGATATCCGGCTCCGGACCCGAGAGAGATGCAGCTCCGTGACGGGCGGGACCCGAGAGATGGGCGTGAGGTGATG
GGAAGAGGCCTCAGGCCGCACGAGTACGAGCGTCATGCTGACAGGTCGTACTTTGAGCAGCAGCGTGAGGCCCTC
GTCGGCGAGATTGCCACCGTACGCCTCGTCTCCGAATTCTCGTCTCTTCTTACATTCTGGTTCTTGCTGATCATG
TCGCCGTCACAGAGCTTCGAGCACGTGCTCGCCAACATCAACAAGCTAAACAGGTCCCTCGAGGCTGTCATTGCC
GTCGGCAACGAGTTCTCGTCCGTCGAGGCGCTTTGGTCGCAGTTTGAAAATGTCATGGGCAACAAGGAGGGTGAT
GGCGATGAGCAGGATGCTACCAAGTCGGAGGCGCAGCAGCAGCAGCAGCAGCAGAAGGGGGACAGCCAGTCTTGA
Gene >Ophun1|3900
ATGCCACCTCCTACTCACCACGACCCTCCCTTCAGGGCCTCTAGGTACTCAAGATACGACTCCGACCGCCGGTCA
AGATCTCCAAGGGACCGCTCGCCCGACCGCTTTGACCGCACCTCGCAGTACGGGGACGGTGAGAGGCGGCGCTCT
TCGGCCGAGGCCAGATCCACCTCTTCAGCTTTCCCGCAAGCCCGCGACTCTTTCGGCGATCCTTTGCGAAGAGAA
CCTCCCCGCGGGCCCAAGGCGCTTGTCGAGCCTTCTGGTGGCCCCAGGGGCGGCGCCTTCGGGGCCGACTTCAGA
GGCAGCAGGGGTCGCGCTCGAGGACGACCCTGGCCTGCACGGGATGGCTCGAGGGATCGCGGAAGGGATCGAGAC
ATGGACTATCGAGACCGCTACCGCGACGAGAGGAGTCGAGAACGCGATCGTGACCGCGAGAGGGATCGCGACTGG
CGAGAGTCGAGAGATTTTCGAACTCACCGCTCCCCGGTTGCTAGGGCCCGCTCGCCCCTCAGAGACTTCCGTGAC
CGTGACCGAGACCGGGATCGGGATCGCGACGGGCCATCTGCCGCCGATGCTGACCGGTCGCGCCGCGATTCTCGA
GATGGCGGGCCCCCTTCGGCCGGCTCGACGACTTCGGATCCCCAATTTGCCCTGTCTGCCTTTGGCCGTGGTGGA
GGCTACATCCGGGGTCGGGCGAGGGGCGGTCGGGGAGAGTGGACCTCGTCCGAGAGAGGCCGCGGGCGGACCTCA
TACGACGACCGTGGCGATCGCTATCCCAGAAGTCGCAGCCAAGAGGGACGCTGGACACGCGATCGAGACGAGCGA
GACCGCAGCGACAGATATCCGGAGCCAGATCCGCGCCGCGACCTTCGTGAAGACCGTGACCGCGGTGATCGAGAC
TTGATACGATCAAAAAAGGAGAGTCGCCCGCAGGATCCTCCGACACAGTCCAGAGAGGTCTCCCCCCCCCCCGTT
GCGCCGTCGGCACCGGCTTTTGGGTCTGTTCCGAGCCGCAGCGCGAGCGGCGGTGATGTTTCCCTCTCGTCAAGC
GCCGTGAGGCCTCATTCGACTTCGAAAGCCAACGTCGAACGTCCCGTTTCTGCCGGTCACGAACTACCCTTCTCT
TCAGTGGGTTCATCCCGAAGCTCCATCTATGATCATCAGTCTATCCCTCTTGGTCCTCGATCCCAGCAGCAACGT
CCTTCGAGTAAGCAGTGGATCAACCCCGGCCTCAAGATGGGCCCGGAGTCGCCCAAGATGATCAGGGGCCAAATA
ACTCCCCAGCAAAGCACGATTCCCTTCAGACGGCCAAGTTCACAAACCGATCAAGCGGAGCACCAGCGGCCCGGG
AGTAGCGATGCCATGCCGCCTTCACGAGTATCGGGCTCCGAAGAGAGGCCTCGTTCACAGCATAGTGCCGAGCCC
GGCGAGATCACCACCAGATCCGAGCCCGCTTTCCGTCAACAGCGGAATCCGGCCGATCGAAACGTGATATTCCAC
GACGCATCGGATATTGACGCACCGTCGAGAGAAGCGGGGGAGCCCATCAGACGTCTCGGGCCAGCTACCGAAGGG
GTCGACGAGCAAACCTCACCGATGGCATCGTCGAAGCGGAAACGGGGACGACCGGACGTTTTGGTTGTGCGATTC
TCCGTGCCTCCCAAGAAAACGGTGCCGGAGCAAGTATCAGAGTCCGACGACGATGACGACATGGCCGACTACTTC
GATATGGAGATCAAGAAGACGGAAGAGAAGTTGAGCAATCTGCCGGAACCGGATCTTCCTCGCGAAGTGGTGGCG
CGCTACGCAGCTGTGTCTCATGGATCGATGGTGCAGATCTTGAACGAGAGCGAGGGCCTCGCCAAGATGCTAATG
ACGCCCCTCGAAGAATCGCATGACGGCAAACAGACCGTTGACGAGCCCGTCGCATCCAAGTCCGAGATGCCGGAA
CCGGAACCGCGCGCCCCCGCCGTGTCTCCTGAAGCCGCGGAGCCGATGGTTGTCGACACGCAGATGGAAGAGCCA
AAAAAGGAGTCCGACACGAAAGTGGACGATGTCAAGATCGGCCCTTCTGGTGTCGACGCGCCACCTTCTACCGAC
CCAGCACCTGCAAAGGTCAGCGACGTCGCCCCAGTCTCGTCAGTCGCGCCTGAGTCCAAGGCGGCTCATGCCAAG
GGAGAGGAGGCATCATCAAAAGATCGCGTTCCACCAGAACCGGTCGCAAACGGTTCGAAAATTCCAAGCACGCCC
TCGCAGGTTGCCGACGACGACGATGACGATGACGACGAGACCGAGTCCGACGACGAAGCCTTCGTGGATGCTCAA
AAGATCCGCCAGTTCATGGTCACGCCACCTGTGGACAGCCTTCCAGACTACAGCATGCCAGATTGGACCAAGGAC
AAGGAGTTTCTGGCGTCGCTGGAGCCCGATCCGATGATGAACGATTTCGTGACCGAGCATCTCAGAAAAGTTCAT
CTACAGCAAGTCGAGGAGCAGAGTCAAGGCCGGAAAGCCTACGCCGAAAACTACGTCCGCTACCTCGATTTCACC
TTGTCCGACGATCCTACCGCTGTCAAGAGCAGGGACAAGTTCTCTCTCTCGGCCCCGTCTGTGGAAGCCGGCGGC
ACCGTCACGCCAGAGACAAAACCCGAGGGTCGCGGAACGGGAAGACGGTTCGCAACCGAGCGCGACCTGGAACGT
GTCCTTCAGGCTTCTATGCGCGAGGACGAGGAGAGGAAAGAGCGAGAGCTGCGAGCCCAGAAAGAAAAGTATCGC
AGCGACAAGGAGGCCGTCATTCCCGACATGTACTGGAGCGAGGAGCAGCGGAGCAAGGCTCAGTACATTGACCAG
TCGGGATTCGTTTCCCCGGAGAGGCTCGTATCCCAGTGGAATGTGCTGCCGCCCGTCAACAACTTTACCCAGGAA
GAAGCTGAGCTGTTTGAGAAGCGATACCTTGAGCTGCCCAAGCAATGGGGCAAGGTGGCCGAGGCCTTACCGAGG
CGCGACTTTGGCACGTGCATCCAATACTACTACCTGATGAAGAAGGAGCTCAACCTCAAGGAGAAGCTCAAGAAG
CAACCAAAGAGGCGCAAGAAGGGCGGAAGGGGCAAGCAGAGATCGAGCGCATTGGTATCGGAGCTTGGCAACGGC
GAACAAGAGGGCGAAGAGAACCCAGACACCGGGGAGAACGGCGAGCGGCGACGGCCGAGGCGAGCAGCCGCTCCC
ACCTGGGGCTTCGAACAGCCGGCGACGGACAGCGAGAACGCGACGCCGGCGGGGACGCCTGGTCGTCGGGGGGCC
TCGACGGTTGCGAAGACGGACCAGCCGGAGAAGACGGATGGCAGGAAGGGGAGACGGAAGACGGCCAAGGACAAG
GAGCCCAAGGCTGCCAAGGCGGCTCCAGTCCCAGCAACGACGCAGGTCCCGGCCGCGTCGGCTCCATCCGGCGGA
AGAGGACGCTCGCGTTCCAGCTCGCGAGCCCCCAATACCGAGTTCCCGACGGGCGCCCCTCCTGACGCCAGCAGT
GCCCGCATGCCAACCGCCCCTTTCGAGCAGCCGACTGCGGTGCCCTCGGGCATACAGCCGCCCTTTGCCCTGCAG
CAGCAGCAGCAGCAGCAGCAGCAGCAGCCCCTTGCCATGGGCGAGCGGCCGAAGCCTATGGTCGCCTCGTCCATG
TCCGAGGTTATGACGGCCCCTTCACTCCGCCCCGAGCCGCCTCCACCCCACCAGTCTTCGATGACCACGTTCAAC
CTCGCCCAGCCCCATACCGAACGCAAGACGACGACACAGCCAACCAGTTACTGGAGCGTATCCGAGGCCAACGAT
TTCCCCAACTTGCTACGGGCTTTTGGATCCGACTGGACATCCATTGCCGCCCACATGGGCTCGAAAACGGCTGTC
ATGGTAAGAAGGTTCCTTCCTCCGGCCGGGTAAATGCTAATCGCTTCTATGATTTCAGGTCAAGAACTACTTTGT
TCGACAGAAGGATCAAGGCAAGGCAGAGTGGGAAGGCATTGTTCAAGAAGCCGAAGCAAAGCGGCTACGAGGCGA
GAAGCGGCCCGATCCTCCACAGCCGACAGCCGGCAGCCGCGGCAGAAGATACGATAGCTCGACGACGGCGACTGC
GAGCTCGTCAAGGCCACTCGCCGTGGCGCCGGGCATAGATATCCCCAGCGAGGCTATACAGGCCAAGATGGAGGG
TCCGCCGCAGCAGCCACGAACGCAGACGTTCCCCAGCTACGGCGTCCCGATCGCTCAGGCACCCGCTCACCAGCC
CCTCGCCCAGCCAGCTCAGCAGCCTCTGGCCATGCAGCAGCACGGCCCGCCGCCGCCGCCGCAGCAGCAGCAACA
ACAACAGCAGCAGCAGCAGCAGGGCATGTCACCGACGAGTCATCCGCTGCGGGCGCCAATGCAGCAGCCTTTCGG
GTTCGTCGACCGCGAGCCTCCTCCACAACAACAGCAGCAGCAGCAGCAGCCGCAGCCGCAGATGACGCATCCTCC
ACAGAGGGCAGTTGCAGTCGCGGTTCCGGACGGGCGCGAGCAACGGCAGCTGGCCGCCGCACAGCCTCTGCAGCC
GACGCGGTCCGACGCCATCATGGAGCGGCAGAAGATGGCGATGGAGCGCGAGATGGAACGCGAGAAGGAGCGCGA
GAAGGAGCGCGAGCGGATGAGAGAGAGGGAGCGTGAGAGGGCGCGAGAGAGAGAAGAACGGGAAAGAGAACGAGA
GCGCGAGCGCGAGAGGGAACGTGAGAGGGAGCGCGACTTGGAAAGAGAACGCGAGCGGGAGAGGGAGCGCGAGCG
GGAGCGCGAGAGGGAAAGGGAAAGGGAGCTTCTGCGGCAGGCCGAGCGACAGGCCTTGAAGACCAGCCAGGAGGC
GGATCGGGCCAGCCAGCGCCATTACGATCCATACGGCCACCGCCAGCAGCCCGGGCATGGGGGAGTCGTGGCAGC
GGGCACGAGGGAGCCCCTGAATCTCGTCCGCACTCCGTCTCAGGAGCCAGCTCGATCTGGTTCCCAAGCCTATCC
CCCGTCGATGCAGCAGCACCCTGCTATACAGCAGCACGGCACGGTCCAGCATCACCCTTCTGTGCCGCCGCCGCC
GCAGCAGCAGCAGCAGCAGCAGAAGCAACAGAAGCAGCACGCTCCCAGTGCTCAGCAACATGCACACCCCGGAGC
GCAGCAACACGCGTCGGTTCAGCAGCATCCTCCGGTGAAGCAGCATCCCGCTATCCAGCAGCATCCTTCTGTCCA
CCACCAACACCAACATCAACAGCAGCCACCTCCTCATATGGTGCGGAATCTGATGGGCGAGCCACCCATGGCGAC
ATCCCGCCCGCTATCGTCGCTTCAGCACAGGCAATCCTCGGGGCCGCCCGTCTCGGAGCCGTATGGCGTTGGGCC
GCCAGCTCCAGCCGCGCCGGCAGCCGTATCAGCAGCCAAAGCCCGTCCACCCGAGCCTCGGAAGACGTCCAACAT
TATGTCTCTCCTCAACGACGATCCCCCCCCGGCGACCAAGCGCGTCAGCGACGTCTCGGCCAGCATGCCTGGATC
TTCGGCGACGCCCCCTCCGCAGAGCTTGGGCCGGACTCCTCCTGGGCCGGCGCCGCCGAGCCAAATGAGGCGAGA
GCCGGAAGGGCAGTATTCCCCTTACGGCCGGGGTCCATCGGGCGGCGGTCCCGGCATGCCGCCTCTCAAGCCGAC
CTACTCCAACTCGCCCGGTCCGGCGCAGCACCTGGCTTCGAGCGAGCGGGACTATTACAGGCAGCATGCCTACGC
GCGCGGGCACCACGGAAGCGGGACCAGCTCTCCCCAGGCGTCACATCGCTACCCAACGCCCGGCCAGTCGACGCA
GGCTCAGTATCAGACGCCCGGCGGCTACCACGCTGCCTACGCAGGCGGACAGCACGCCGCATCGCCGCCGCCGCA
ATACGCGGTGCACGGTTCGGCTTCTCGTGCTCGCGAGGTGCCTCAGGGGGGTCGTGAGAACGCGTGGCCTCAGCA
GGGCCACTCGCAGGGCCACTCGCAGAGCCACCCGCAACAGGGCCATCCGCAACAGGGCCACCCGCAACAGGGCCA
CCCGCAACAGGGTCATCAGCAGGGCCACCCGCCCCAGGGTCATCCGCAACAGGGCCACCCGCAGCAGGGCCACCC
GCAGGGCCACCCGCAAGGCCACCCGCAGGCCGCAGCCAGCATGCAGCAAGGCGGCGGATGGCCGACTCCATCCAA
GGTGCAGGGACCGCCGCCGCCTCAGGCACAGCCGTGGGGGGGCCAGCATCCGTCGACGACGCCCGGCCCGTCGAC
GCCAGCACAGCAGCCCTGGGCGCCTCCGCAGCAACAGCAGCAGCCGCCTTCGCAGCAGCACCACATGAGCATGCG
GGATGAGCGCGTGTACGGCTCAAGCTCGCAGCCACCTACACACCGGTACGCGACACCGGCGCCGCGCGGGCCGGA
TTCGATGGCGCCTCAGGCACAGCCTTATCCCCGGTACGCGTCGACACCCGGGCCCGGGGCGCCGCGAGACCCCCG
GGAGGTAGGTCGGAGCTACACGCCGGGCATTTACGACACGCGCGGTCCTCCTGTTGGATATCCGGCTCCGGACCC
GAGAGAGATGCAGCTCCGTGACGGGCGGGACCCGAGAGATGGGCGTGAGGTGATGGGAAGAGGCCTCAGGCCGCA
CGAGTACGAGCGTCATGCTGACAGGTACGGACGATGACGATGAGTGGGTGAGAGGAACTGGTATATGTACATGGT
GAATTCGTAATTGCATACTCGTACCGACGATTGAATGCAAGAGTTGGTCCATGTAATAGCAGAAGGGAGACTCAA
CGTTGGTATATCTGAAAGGCGGGATGGAGTTGTTGGCTCAGTGGATACCTTGTGGATACCTACCACCGGAAGCGG
GAGAAAATCCGGCCGAGGCCATGAGACGCGAAGCCAAGACGCGACTCTCGTGGTGGATTCTCTCTTCAGCCTCGT
CCAACGATTGCATAATGCCGCCGCCGTACGGGCGCCCTCCGACGGCCGATCCGGGGCGCGAAAGGTCGTACTTTG
AGCAGCAGCGTGAGGCCCTCGTCGGCGAGATTGCCACCGTACGCCTCGTCTCCGAATTCTCGTCTCTTCTTACAT
TCTGGTTCTTGCTGATCATGTCGCCGTCACAGAGCTTCGAGCACGTGCTCGCCAACATCAACAAGCTAAACAGGT
CCCTCGAGGCTGTCATTGCCGTTCGTCACCTTGCTAAACACGTTGCCATTGAGGCGAAGCTGATGGTTGGCTTTA
CAAACGCAGGTCGGCAACGAGTTCTCGTCCGTCGAGGCGCTTTGGTCGCAGTTTGAAAATGTCATGGGCAACAAG
GAGGGTGATGGCGATGAGCAGGATGCTACCAAGTCGGAGGCGCAGCAGCAGCAGCAGCAGCAGAAGGGGGACAGC
CAGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail