Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3892
Gene name
LocationContig_351:6090..6594
Strand-
Gene length (bp)504
Transcript length (bp)387
Coding sequence length (bp)387
Protein length (aa) 129

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07955 DUF1687 Protein of unknown function (DUF1687) 9.3E-24 2 112

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UTA2|FMP46_SCHPO Putative redox protein fmp46, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fmp46 PE=3 SV=1 47 110 1.0E-09

GO

GO Term Description Terminal node
GO:0005739 mitochondrion Yes
GO:0016491 oxidoreductase activity Yes
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0003824 catalytic activity No
GO:0043227 membrane-bounded organelle No
GO:0043231 intracellular membrane-bounded organelle No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4950
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6617
Ophiocordyceps australis map64 (Brazil) OphauB2|3101
Ophiocordyceps camponoti-floridani Ophcf2|00824
Ophiocordyceps camponoti-rufipedis Ophun1|3892 (this protein)
Ophiocordyceps kimflemingae Ophio5|595
Ophiocordyceps subramaniannii Hirsu2|1903

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3892
MFRFRKTADVITLFARPGSAASSRVASLLRQTSARLQAPENTGRDPFELDVTEELPTAGQVETMLEYAGEGGVPR
LVKGARDIQDALQRFKQSGDSLQRPVTVDWDKGKVVVGDNESEILKLVNARKE*
Coding >Ophun1|3892
ATGTTTCGCTTCCGCAAAACCGCAGACGTCATCACCCTCTTCGCCCGGCCTGGCTCCGCAGCATCCAGCCGCGTC
GCCTCCCTGCTGCGGCAGACGTCGGCGCGCCTGCAAGCTCCCGAGAACACCGGTCGCGATCCCTTCGAGCTCGAC
GTCACAGAGGAGCTGCCGACGGCCGGACAGGTCGAGACCATGCTCGAATACGCGGGAGAGGGGGGCGTGCCGCGT
CTGGTCAAGGGCGCGCGGGATATTCAGGATGCGTTGCAGCGGTTCAAGCAGAGTGGCGATAGCCTCCAGCGGCCG
GTGACGGTCGACTGGGATAAAGGAAAGGTAGTGGTAGGCGACAACGAGTCCGAGATTCTCAAACTAGTCAACGCT
CGCAAGGAGTAA
Transcript >Ophun1|3892
ATGTTTCGCTTCCGCAAAACCGCAGACGTCATCACCCTCTTCGCCCGGCCTGGCTCCGCAGCATCCAGCCGCGTC
GCCTCCCTGCTGCGGCAGACGTCGGCGCGCCTGCAAGCTCCCGAGAACACCGGTCGCGATCCCTTCGAGCTCGAC
GTCACAGAGGAGCTGCCGACGGCCGGACAGGTCGAGACCATGCTCGAATACGCGGGAGAGGGGGGCGTGCCGCGT
CTGGTCAAGGGCGCGCGGGATATTCAGGATGCGTTGCAGCGGTTCAAGCAGAGTGGCGATAGCCTCCAGCGGCCG
GTGACGGTCGACTGGGATAAAGGAAAGGTAGTGGTAGGCGACAACGAGTCCGAGATTCTCAAACTAGTCAACGCT
CGCAAGGAGTAA
Gene >Ophun1|3892
ATGTTTCGCTTCGTAAGACGACCAAGATCTACTTCAGCAAACGTCTTTCACCGCTAACAACCGCATCCTACTCCT
CCGCAGCGCAAAACCGCAGACGTCATCACCCTCTTCGCCCGGCCTGGCTCCGCAGCATCCAGCCGCGTCGCCTCC
CTGCTGCGGCAGACGTCGGCGCGCCTGCAAGCTCCCGAGAACACCGGTCGCGATCCCTTCGAGCTCGACGTCACA
GAGGAGCTGCCGACGGCCGGACAGGTCGAGACCATGCTCGAATACGCGGGAGAGGGGGGCGTGCCGCGTCTGGTC
AAGGGCGCGCGGGATATTCAGGATGCGTTGCAGCGGTTCAAGCAGAGTGGCGATAGCCTCCAGCGGCCGGTGGTG
CGTCTCTTTGATTCATTTACTCTGCCAGACACTGACGCTCTGTAGACGGTCGACTGGGATAAAGGAAAGGTAGTG
GTAGGCGACAACGAGTCCGAGATTCTCAAACTAGTCAACGCTCGCAAGGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail