Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3885
Gene name
LocationContig_350:919..2815
Strand-
Gene length (bp)1896
Transcript length (bp)1896
Coding sequence length (bp)1896
Protein length (aa) 632

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13402 Peptidase_M60 Peptidase M60, enhancin and enhancin-like 4.6E-50 323 581
PF17291 M60-like_N N-terminal domain of M60-like peptidases 1.4E-11 208 314

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6NFQ2|TCAF2_HUMAN TRPM8 channel-associated factor 2 OS=Homo sapiens GN=TCAF2 PE=1 SV=2 139 581 2.0E-08
sp|Q6QR59|TCAF3_MOUSE TRPM8 channel-associated factor 3 OS=Mus musculus GN=Tcaf3 PE=1 SV=1 228 597 3.0E-08
sp|Q5XHI4|TCAF_XENLA TRPM8 channel-associated factor homolog OS=Xenopus laevis GN=tcaf PE=2 SV=1 287 596 3.0E-08
sp|Q6P6V7|TCAF3_RAT TRPM8 channel-associated factor 3 OS=Rattus norvegicus GN=Tcaf3 PE=2 SV=1 228 597 9.0E-08
sp|Q8BNE1|TCAF1_MOUSE TRPM8 channel-associated factor 1 OS=Mus musculus GN=Tcaf1 PE=2 SV=1 154 588 5.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6NFQ2|TCAF2_HUMAN TRPM8 channel-associated factor 2 OS=Homo sapiens GN=TCAF2 PE=1 SV=2 139 581 2.0E-08
sp|Q6QR59|TCAF3_MOUSE TRPM8 channel-associated factor 3 OS=Mus musculus GN=Tcaf3 PE=1 SV=1 228 597 3.0E-08
sp|Q5XHI4|TCAF_XENLA TRPM8 channel-associated factor homolog OS=Xenopus laevis GN=tcaf PE=2 SV=1 287 596 3.0E-08
sp|Q6P6V7|TCAF3_RAT TRPM8 channel-associated factor 3 OS=Rattus norvegicus GN=Tcaf3 PE=2 SV=1 228 597 9.0E-08
sp|Q8BNE1|TCAF1_MOUSE TRPM8 channel-associated factor 1 OS=Mus musculus GN=Tcaf1 PE=2 SV=1 154 588 5.0E-07
sp|Q9Y4C2|TCAF1_HUMAN TRPM8 channel-associated factor 1 OS=Homo sapiens GN=TCAF1 PE=1 SV=3 154 588 7.0E-06
sp|A5PJN5|TCAF1_BOVIN TRPM8 channel-associated factor 1 OS=Bos taurus GN=TCAF1 PE=2 SV=1 287 588 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3885
MAHLKPSLPLLTSLLLINVSNPTPFQNTTLHVTNHQPTTPFSNTSTPFRNISTPLADLQVHQQSSTLYPLQKQTI
WVKARNAGPAAEATLVLESPPLKGVGLSITHVSGGCEQLGLASERIRCEWRGVKSVEAHLEIGLRYDGVSSVDRI
EMPLTLTAFLDHQGPDVSFRRIHKLHWNIRYPEKYEYNMSNNKYFPHPSAIKVKALPRATDEARRLRQWFQWADF
EPTGFYLRPQKPLQIIILGGSATGSRPDLLIGTPGLVNARRRSDNSLMGQQQIKPLQFGVNSITCPVGGIMYIRY
TFPKGKKPPPDITVVLYGDKAAQPFPLFRQGTTTDEQWNKMLRVTTVPYAELSGQRVIVTGLAEDAQKYARLGQK
QDELLEAYESIISAQDRISGLFRHGVSAQHRPSPLRPMVMQTSNGRNAHAWHLRAALPAREHQDIWWKPSVENSW
QLWHELGHQRQHIFTWSWPQVQESTVNIYALASRRMWPQRASEHGSSGEWDTARRYLAERTVDFDHANHFVQLAM
FDQLRQVFGDDFYHQLHALSRQSPTKRKPQEKKHFFMTRAALVAQQDLSDYFERWGLEPDVATLSWMRVLPEPWW
DYTLTPAFVPVSEATRAKWRLQGEEKRREPC*
Coding >Ophun1|3885
ATGGCTCATCTCAAACCCAGCCTCCCTCTACTAACCAGCCTCCTTCTCATCAACGTCTCCAACCCAACGCCCTTC
CAAAACACCACTCTACACGTAACCAACCACCAGCCAACCACCCCTTTCAGCAACACCAGCACTCCCTTCAGAAAC
ATCAGCACCCCCCTCGCAGACCTACAAGTCCACCAGCAATCGTCAACGCTGTACCCCCTGCAGAAGCAAACCATC
TGGGTGAAAGCGAGAAACGCGGGTCCCGCCGCCGAGGCCACGCTGGTGCTCGAGTCGCCGCCGCTCAAGGGGGTG
GGCTTAAGCATCACGCATGTTTCTGGCGGGTGTGAGCAGCTGGGGTTGGCGTCGGAGAGGATTCGCTGCGAGTGG
CGAGGGGTTAAGTCGGTTGAGGCTCATCTTGAGATTGGGTTGAGATATGATGGTGTTTCGTCGGTTGACAGGATT
GAGATGCCCTTGACGTTGACGGCCTTCCTCGACCATCAAGGCCCTGACGTATCCTTCCGACGCATCCACAAGCTT
CACTGGAACATTCGATACCCAGAAAAGTACGAATACAACATGTCCAACAACAAATACTTCCCACACCCGTCCGCC
ATCAAAGTCAAGGCCCTCCCCCGCGCAACAGACGAAGCCCGCCGTCTCCGCCAGTGGTTCCAATGGGCCGACTTT
GAACCAACAGGCTTCTACCTCAGACCGCAGAAGCCACTCCAGATCATCATCCTCGGCGGTTCAGCAACCGGCTCG
CGCCCAGATCTCCTCATCGGCACGCCGGGGCTGGTCAACGCTCGGCGACGAAGCGACAATTCGCTCATGGGGCAG
CAGCAGATAAAGCCGCTGCAGTTCGGAGTCAATAGCATCACTTGTCCCGTCGGAGGGATCATGTACATCCGATAC
ACGTTTCCGAAGGGTAAGAAGCCGCCGCCGGACATCACCGTCGTTCTATACGGAGACAAGGCCGCTCAGCCGTTT
CCGCTATTCCGGCAGGGAACCACAACAGACGAGCAATGGAACAAGATGCTGCGAGTCACGACCGTTCCCTACGCC
GAGCTATCCGGCCAACGTGTCATCGTCACAGGCCTGGCAGAAGACGCCCAGAAATACGCGAGGCTGGGCCAGAAA
CAAGACGAGCTACTGGAAGCCTACGAAAGCATCATCTCGGCACAGGACAGAATCAGCGGCCTCTTCCGCCACGGA
GTCTCAGCCCAGCACCGGCCCAGCCCACTCCGACCCATGGTAATGCAGACGTCCAACGGCCGCAACGCCCACGCA
TGGCACCTCCGAGCCGCGCTCCCAGCCCGAGAACACCAAGACATCTGGTGGAAGCCAAGCGTGGAGAACTCGTGG
CAACTGTGGCACGAACTGGGCCATCAGCGTCAGCACATCTTCACCTGGAGCTGGCCGCAGGTGCAGGAATCAACG
GTCAACATCTACGCGCTGGCCAGCCGACGGATGTGGCCCCAACGAGCATCGGAGCACGGCTCCAGCGGAGAATGG
GATACAGCCAGACGATACCTCGCCGAGCGAACCGTCGACTTTGACCACGCAAACCACTTCGTCCAGCTAGCCATG
TTCGACCAACTCCGCCAAGTCTTTGGCGACGATTTCTACCATCAGCTTCACGCCCTCTCCCGGCAATCGCCGACC
AAGCGCAAGCCGCAGGAGAAGAAGCACTTCTTCATGACGCGCGCCGCGCTCGTCGCCCAGCAGGATCTGAGCGAC
TACTTTGAGAGATGGGGGCTGGAGCCGGACGTGGCGACCTTGTCGTGGATGAGGGTGCTTCCGGAGCCGTGGTGG
GATTACACGCTGACGCCTGCGTTTGTGCCTGTTTCGGAGGCGACGAGGGCCAAGTGGCGGTTGCAGGGAGAGGAG
AAGAGGCGAGAGCCGTGTTGA
Transcript >Ophun1|3885
ATGGCTCATCTCAAACCCAGCCTCCCTCTACTAACCAGCCTCCTTCTCATCAACGTCTCCAACCCAACGCCCTTC
CAAAACACCACTCTACACGTAACCAACCACCAGCCAACCACCCCTTTCAGCAACACCAGCACTCCCTTCAGAAAC
ATCAGCACCCCCCTCGCAGACCTACAAGTCCACCAGCAATCGTCAACGCTGTACCCCCTGCAGAAGCAAACCATC
TGGGTGAAAGCGAGAAACGCGGGTCCCGCCGCCGAGGCCACGCTGGTGCTCGAGTCGCCGCCGCTCAAGGGGGTG
GGCTTAAGCATCACGCATGTTTCTGGCGGGTGTGAGCAGCTGGGGTTGGCGTCGGAGAGGATTCGCTGCGAGTGG
CGAGGGGTTAAGTCGGTTGAGGCTCATCTTGAGATTGGGTTGAGATATGATGGTGTTTCGTCGGTTGACAGGATT
GAGATGCCCTTGACGTTGACGGCCTTCCTCGACCATCAAGGCCCTGACGTATCCTTCCGACGCATCCACAAGCTT
CACTGGAACATTCGATACCCAGAAAAGTACGAATACAACATGTCCAACAACAAATACTTCCCACACCCGTCCGCC
ATCAAAGTCAAGGCCCTCCCCCGCGCAACAGACGAAGCCCGCCGTCTCCGCCAGTGGTTCCAATGGGCCGACTTT
GAACCAACAGGCTTCTACCTCAGACCGCAGAAGCCACTCCAGATCATCATCCTCGGCGGTTCAGCAACCGGCTCG
CGCCCAGATCTCCTCATCGGCACGCCGGGGCTGGTCAACGCTCGGCGACGAAGCGACAATTCGCTCATGGGGCAG
CAGCAGATAAAGCCGCTGCAGTTCGGAGTCAATAGCATCACTTGTCCCGTCGGAGGGATCATGTACATCCGATAC
ACGTTTCCGAAGGGTAAGAAGCCGCCGCCGGACATCACCGTCGTTCTATACGGAGACAAGGCCGCTCAGCCGTTT
CCGCTATTCCGGCAGGGAACCACAACAGACGAGCAATGGAACAAGATGCTGCGAGTCACGACCGTTCCCTACGCC
GAGCTATCCGGCCAACGTGTCATCGTCACAGGCCTGGCAGAAGACGCCCAGAAATACGCGAGGCTGGGCCAGAAA
CAAGACGAGCTACTGGAAGCCTACGAAAGCATCATCTCGGCACAGGACAGAATCAGCGGCCTCTTCCGCCACGGA
GTCTCAGCCCAGCACCGGCCCAGCCCACTCCGACCCATGGTAATGCAGACGTCCAACGGCCGCAACGCCCACGCA
TGGCACCTCCGAGCCGCGCTCCCAGCCCGAGAACACCAAGACATCTGGTGGAAGCCAAGCGTGGAGAACTCGTGG
CAACTGTGGCACGAACTGGGCCATCAGCGTCAGCACATCTTCACCTGGAGCTGGCCGCAGGTGCAGGAATCAACG
GTCAACATCTACGCGCTGGCCAGCCGACGGATGTGGCCCCAACGAGCATCGGAGCACGGCTCCAGCGGAGAATGG
GATACAGCCAGACGATACCTCGCCGAGCGAACCGTCGACTTTGACCACGCAAACCACTTCGTCCAGCTAGCCATG
TTCGACCAACTCCGCCAAGTCTTTGGCGACGATTTCTACCATCAGCTTCACGCCCTCTCCCGGCAATCGCCGACC
AAGCGCAAGCCGCAGGAGAAGAAGCACTTCTTCATGACGCGCGCCGCGCTCGTCGCCCAGCAGGATCTGAGCGAC
TACTTTGAGAGATGGGGGCTGGAGCCGGACGTGGCGACCTTGTCGTGGATGAGGGTGCTTCCGGAGCCGTGGTGG
GATTACACGCTGACGCCTGCGTTTGTGCCTGTTTCGGAGGCGACGAGGGCCAAGTGGCGGTTGCAGGGAGAGGAG
AAGAGGCGAGAGCCGTGTTGA
Gene >Ophun1|3885
ATGGCTCATCTCAAACCCAGCCTCCCTCTACTAACCAGCCTCCTTCTCATCAACGTCTCCAACCCAACGCCCTTC
CAAAACACCACTCTACACGTAACCAACCACCAGCCAACCACCCCTTTCAGCAACACCAGCACTCCCTTCAGAAAC
ATCAGCACCCCCCTCGCAGACCTACAAGTCCACCAGCAATCGTCAACGCTGTACCCCCTGCAGAAGCAAACCATC
TGGGTGAAAGCGAGAAACGCGGGTCCCGCCGCCGAGGCCACGCTGGTGCTCGAGTCGCCGCCGCTCAAGGGGGTG
GGCTTAAGCATCACGCATGTTTCTGGCGGGTGTGAGCAGCTGGGGTTGGCGTCGGAGAGGATTCGCTGCGAGTGG
CGAGGGGTTAAGTCGGTTGAGGCTCATCTTGAGATTGGGTTGAGATATGATGGTGTTTCGTCGGTTGACAGGATT
GAGATGCCCTTGACGTTGACGGCCTTCCTCGACCATCAAGGCCCTGACGTATCCTTCCGACGCATCCACAAGCTT
CACTGGAACATTCGATACCCAGAAAAGTACGAATACAACATGTCCAACAACAAATACTTCCCACACCCGTCCGCC
ATCAAAGTCAAGGCCCTCCCCCGCGCAACAGACGAAGCCCGCCGTCTCCGCCAGTGGTTCCAATGGGCCGACTTT
GAACCAACAGGCTTCTACCTCAGACCGCAGAAGCCACTCCAGATCATCATCCTCGGCGGTTCAGCAACCGGCTCG
CGCCCAGATCTCCTCATCGGCACGCCGGGGCTGGTCAACGCTCGGCGACGAAGCGACAATTCGCTCATGGGGCAG
CAGCAGATAAAGCCGCTGCAGTTCGGAGTCAATAGCATCACTTGTCCCGTCGGAGGGATCATGTACATCCGATAC
ACGTTTCCGAAGGGTAAGAAGCCGCCGCCGGACATCACCGTCGTTCTATACGGAGACAAGGCCGCTCAGCCGTTT
CCGCTATTCCGGCAGGGAACCACAACAGACGAGCAATGGAACAAGATGCTGCGAGTCACGACCGTTCCCTACGCC
GAGCTATCCGGCCAACGTGTCATCGTCACAGGCCTGGCAGAAGACGCCCAGAAATACGCGAGGCTGGGCCAGAAA
CAAGACGAGCTACTGGAAGCCTACGAAAGCATCATCTCGGCACAGGACAGAATCAGCGGCCTCTTCCGCCACGGA
GTCTCAGCCCAGCACCGGCCCAGCCCACTCCGACCCATGGTAATGCAGACGTCCAACGGCCGCAACGCCCACGCA
TGGCACCTCCGAGCCGCGCTCCCAGCCCGAGAACACCAAGACATCTGGTGGAAGCCAAGCGTGGAGAACTCGTGG
CAACTGTGGCACGAACTGGGCCATCAGCGTCAGCACATCTTCACCTGGAGCTGGCCGCAGGTGCAGGAATCAACG
GTCAACATCTACGCGCTGGCCAGCCGACGGATGTGGCCCCAACGAGCATCGGAGCACGGCTCCAGCGGAGAATGG
GATACAGCCAGACGATACCTCGCCGAGCGAACCGTCGACTTTGACCACGCAAACCACTTCGTCCAGCTAGCCATG
TTCGACCAACTCCGCCAAGTCTTTGGCGACGATTTCTACCATCAGCTTCACGCCCTCTCCCGGCAATCGCCGACC
AAGCGCAAGCCGCAGGAGAAGAAGCACTTCTTCATGACGCGCGCCGCGCTCGTCGCCCAGCAGGATCTGAGCGAC
TACTTTGAGAGATGGGGGCTGGAGCCGGACGTGGCGACCTTGTCGTGGATGAGGGTGCTTCCGGAGCCGTGGTGG
GATTACACGCTGACGCCTGCGTTTGTGCCTGTTTCGGAGGCGACGAGGGCCAAGTGGCGGTTGCAGGGAGAGGAG
AAGAGGCGAGAGCCGTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail