Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3883
Gene name
LocationContig_35:46142..48807
Strand-
Gene length (bp)2665
Transcript length (bp)2457
Coding sequence length (bp)2457
Protein length (aa) 819

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12678 zf-rbx1 RING-H2 zinc finger domain 2.2E-09 348 401
PF13639 zf-RING_2 Ring finger domain 5.6E-08 347 401
PF13445 zf-RING_UBOX RING-type zinc-finger 1.4E-05 349 398
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 2.8E-05 349 400

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5Z880|HRD1_ORYSJ ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Oryza sativa subsp. japonica GN=HRD1 PE=2 SV=1 4 438 3.0E-65
sp|Q95SP2|HRD1_DROME E3 ubiquitin-protein ligase HRD1 OS=Drosophila melanogaster GN=sip3 PE=1 SV=1 10 443 9.0E-57
sp|A8Y4B2|HRD1_CAEBR E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis briggsae GN=sel-11 PE=3 SV=2 3 408 2.0E-48
sp|O74757|HRD1_SCHPO ERAD-associated E3 ubiquitin-protein ligase hrd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrd1 PE=1 SV=1 4 463 4.0E-40
sp|Q6NPT7|HRD1B_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1B OS=Arabidopsis thaliana GN=HRD1B PE=2 SV=1 265 419 3.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5Z880|HRD1_ORYSJ ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Oryza sativa subsp. japonica GN=HRD1 PE=2 SV=1 4 438 3.0E-65
sp|Q95SP2|HRD1_DROME E3 ubiquitin-protein ligase HRD1 OS=Drosophila melanogaster GN=sip3 PE=1 SV=1 10 443 9.0E-57
sp|A8Y4B2|HRD1_CAEBR E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis briggsae GN=sel-11 PE=3 SV=2 3 408 2.0E-48
sp|O74757|HRD1_SCHPO ERAD-associated E3 ubiquitin-protein ligase hrd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrd1 PE=1 SV=1 4 463 4.0E-40
sp|Q6NPT7|HRD1B_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1B OS=Arabidopsis thaliana GN=HRD1B PE=2 SV=1 265 419 3.0E-36
sp|Q9LW77|HRD1A_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1A OS=Arabidopsis thaliana GN=HRD1A PE=2 SV=1 259 405 6.0E-36
sp|Q9LW77|HRD1A_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1A OS=Arabidopsis thaliana GN=HRD1A PE=2 SV=1 4 202 8.0E-28
sp|Q6NRL6|SYVNA_XENLA E3 ubiquitin-protein ligase synoviolin A OS=Xenopus laevis GN=syvn1-a PE=2 SV=1 265 413 1.0E-27
sp|Q5XHH7|SYVNB_XENLA E3 ubiquitin-protein ligase synoviolin B OS=Xenopus laevis GN=syvn1-b PE=2 SV=1 265 413 4.0E-27
sp|Q803I8|SYVN1_DANRE E3 ubiquitin-protein ligase synoviolin OS=Danio rerio GN=syvn1 PE=2 SV=2 265 407 6.0E-27
sp|Q803I8|SYVN1_DANRE E3 ubiquitin-protein ligase synoviolin OS=Danio rerio GN=syvn1 PE=2 SV=2 4 198 1.0E-26
sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=Mus musculus GN=Syvn1 PE=1 SV=3 4 198 2.0E-26
sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens GN=SYVN1 PE=1 SV=2 265 407 3.0E-26
sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens GN=SYVN1 PE=1 SV=2 4 198 4.0E-26
sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=Mus musculus GN=Syvn1 PE=1 SV=3 265 407 5.0E-26
sp|Q5XHH7|SYVNB_XENLA E3 ubiquitin-protein ligase synoviolin B OS=Xenopus laevis GN=syvn1-b PE=2 SV=1 11 198 2.0E-25
sp|Q6NRL6|SYVNA_XENLA E3 ubiquitin-protein ligase synoviolin A OS=Xenopus laevis GN=syvn1-a PE=2 SV=1 10 198 2.0E-25
sp|Q6NPT7|HRD1B_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1B OS=Arabidopsis thaliana GN=HRD1B PE=2 SV=1 4 196 3.0E-25
sp|Q20798|HRD1_CAEEL E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis elegans GN=sel-11 PE=3 SV=1 7 198 9.0E-24
sp|Q20798|HRD1_CAEEL E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis elegans GN=sel-11 PE=3 SV=1 264 408 8.0E-23
sp|Q75CC8|HRD1_ASHGO ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HRD1 PE=3 SV=2 36 417 7.0E-20
sp|Q08109|HRD1_YEAST ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRD1 PE=1 SV=1 3 404 3.0E-18
sp|Q8VYC8|RIN2_ARATH E3 ubiquitin protein ligase RIN2 OS=Arabidopsis thaliana GN=RIN2 PE=1 SV=1 34 409 2.0E-17
sp|Q9UKV5|AMFR_HUMAN E3 ubiquitin-protein ligase AMFR OS=Homo sapiens GN=AMFR PE=1 SV=2 265 407 2.0E-12
sp|Q9R049|AMFR_MOUSE E3 ubiquitin-protein ligase AMFR OS=Mus musculus GN=Amfr PE=1 SV=2 265 410 2.0E-12
sp|Q8W4Q5|RIN3_ARATH E3 ubiquitin protein ligase RIN3 OS=Arabidopsis thaliana GN=RIN3 PE=1 SV=2 21 409 2.0E-09
sp|Q96MT1|RN145_HUMAN RING finger protein 145 OS=Homo sapiens GN=RNF145 PE=2 SV=2 322 458 6.0E-08
sp|Q5SWK7|RN145_MOUSE RING finger protein 145 OS=Mus musculus GN=Rnf145 PE=2 SV=1 246 450 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0046914 transition metal ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 41 63 22
3 102 124 22
4 139 161 22
5 284 306 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3883
MPKMRLGWYAGVSTALAGGVVISAFLQRANFYSAMVYLAQSNFCLLALVNFSLLLYSSFIYGLTRICFGSLRAVE
VEQLTERAWFAITETCLAMTIFREEIGAWFLVMFTALVTGKVWGWIGDGRVEFLEQQPPHNPRLFHLRLSISLGM
SFLYDILILRYSVRNVIQQARPNMMVMFLFEFAVLATCSWRTGARYMLVLAEQNIIKTQTRKRLFERRLEVREQR
EAILRRREQAAAAGEDAAADDEPLPNEDDVDEMDIEVPGWSAKGEWVLWLDLLSDMIKLSIYVAFFFMLLMFYGL
PIHIMRDLFMTSRDFIKRLNALLRYRRAIQEMNRYPDASADDLAQENTCIICREEMRPWDPVENPGAIDRVRPKK
LPCGHILHLGCLKSWLERQQVCPTCRSPVTAARARGRPAAGAAGLRIQIGGQPRPQGQQPPADVDQQGQENDDPQ
PRPPREGGPRIFNIGPIRLGFGTNGQQFRELAQQFGVPHIAGNQAAPAPAAEQNQPTLADNLGSIANLLRQTEQL
LQREAQRMHIAQQELQIVSLLMAELLRLQQRRLQTLEQPLAAQPPLQPWPPAAHGLPMNPPFPPAQQFPVPSLGI
QPQYPGLPILPGAPPRSGSPLMARLGTSGPTAPIPAGSADLPEGLTLPPGWSVVPLQRLDGSPSSASMPHPPQAP
GHEGDAPTNSSQAANEAPASVPFPVGSHPAPPELAADEPPSTEARQTAEPAPVVAPNPVMPNWAGPSQLLNNGPR
VNPEEPERQPAESTSTAMPTTTTAATATAATATVTSEHPDTEGGQESPSSSKGKGKAATVQDARDEEE*
Coding >Ophun1|3883
ATGCCCAAGATGCGGCTCGGCTGGTACGCTGGGGTCTCCACGGCCCTCGCGGGCGGCGTCGTCATCTCGGCCTTT
CTCCAGCGGGCGAACTTTTATTCGGCCATGGTATACCTGGCCCAGAGCAACTTTTGCTTGCTGGCCCTGGTCAAC
TTTTCCCTCCTTCTTTACAGCAGTTTTATCTACGGTTTGACGCGCATATGTTTCGGTTCGCTTCGCGCCGTCGAG
GTCGAGCAACTCACAGAGAGAGCATGGTTCGCCATCACGGAAACGTGCCTCGCCATGACCATATTCAGAGAAGAA
ATAGGGGCCTGGTTCCTGGTTATGTTCACGGCGTTGGTGACGGGCAAGGTGTGGGGCTGGATTGGCGACGGCCGA
GTCGAGTTTCTTGAGCAGCAACCGCCTCACAACCCGCGGCTCTTCCACCTTCGCCTTAGTATTTCCCTCGGCATG
AGCTTCCTGTACGACATACTGATACTGCGATATTCGGTTCGGAACGTCATTCAGCAGGCACGTCCAAACATGATG
GTCATGTTTCTTTTTGAATTCGCGGTACTGGCTACGTGCTCGTGGCGCACAGGCGCTCGGTATATGCTCGTCTTG
GCGGAACAGAACATCATCAAGACGCAGACGAGGAAGAGGCTGTTTGAAAGAAGACTGGAAGTTCGGGAGCAGCGG
GAGGCCATTTTGCGACGGCGTGAGCAAGCCGCAGCCGCAGGAGAGGACGCAGCCGCCGATGACGAACCGTTGCCG
AACGAAGACGACGTCGACGAGATGGACATCGAAGTCCCCGGCTGGTCTGCTAAGGGGGAATGGGTGCTTTGGCTC
GATCTTCTCAGTGATATGATCAAGCTCAGCATCTATGTTGCCTTCTTCTTCATGCTCCTCATGTTCTACGGCTTG
CCCATTCACATTATGAGGGATCTGTTTATGACGTCTCGCGATTTCATCAAGAGACTAAACGCCCTATTGCGCTAT
CGCCGAGCTATACAGGAGATGAACCGATACCCAGATGCGTCCGCCGACGACCTTGCGCAGGAAAATACGTGCATC
ATCTGTCGAGAGGAGATGAGGCCGTGGGATCCGGTTGAAAACCCGGGCGCCATCGATCGGGTACGGCCAAAGAAG
TTGCCTTGCGGCCATATCCTGCACCTCGGCTGTCTCAAGAGCTGGCTTGAGCGGCAACAGGTGTGTCCCACATGC
AGGAGTCCCGTAACAGCCGCTCGAGCTCGCGGCCGTCCTGCAGCCGGAGCGGCCGGGCTCAGGATACAGATCGGG
GGCCAGCCGAGGCCACAAGGCCAGCAGCCGCCGGCGGACGTTGACCAGCAGGGTCAAGAGAACGACGATCCACAG
CCGAGGCCGCCAAGAGAGGGAGGCCCTCGTATATTCAACATCGGGCCCATCCGGCTTGGGTTCGGCACCAACGGC
CAGCAGTTCCGCGAGCTCGCCCAGCAGTTCGGCGTACCGCACATCGCCGGAAACCAGGCGGCTCCGGCTCCAGCC
GCCGAGCAGAACCAGCCGACATTGGCCGACAACCTCGGAAGCATCGCCAATCTCCTCCGACAGACGGAGCAACTA
CTCCAGCGTGAAGCGCAGCGGATGCACATCGCGCAACAGGAGCTTCAGATTGTCAGTCTGCTGATGGCCGAGTTG
CTGCGCCTACAGCAGCGCCGTCTGCAAACGCTGGAACAACCTCTGGCCGCGCAGCCTCCTCTCCAGCCCTGGCCA
CCGGCTGCCCATGGCTTGCCGATGAATCCGCCCTTCCCACCAGCCCAGCAGTTCCCAGTCCCCTCTCTGGGGATA
CAGCCTCAATACCCGGGCCTGCCGATACTCCCCGGAGCACCACCTCGCTCAGGGAGCCCGCTGATGGCCCGTCTC
GGCACTTCCGGTCCCACGGCGCCCATCCCGGCCGGCAGTGCAGACCTTCCGGAGGGACTGACGCTACCTCCTGGA
TGGTCGGTGGTGCCTCTCCAAAGGCTGGACGGTTCCCCAAGCTCAGCCTCGATGCCTCACCCGCCACAGGCGCCC
GGGCACGAAGGAGACGCCCCGACGAACTCGAGCCAAGCAGCCAACGAGGCCCCAGCATCCGTACCCTTTCCAGTC
GGAAGCCATCCCGCTCCCCCAGAACTCGCCGCCGATGAACCCCCTTCGACGGAAGCTCGCCAAACCGCCGAGCCA
GCTCCAGTCGTAGCCCCCAACCCCGTGATGCCCAACTGGGCCGGCCCATCGCAGCTACTAAACAACGGACCCCGC
GTCAACCCCGAAGAACCCGAGCGGCAGCCCGCCGAGTCTACAAGCACAGCCATGCCCACAACAACAACAGCAGCA
ACAGCAACAGCAGCAACAGCAACAGTCACAAGCGAGCATCCCGACACCGAAGGCGGACAAGAATCCCCCTCATCA
TCCAAGGGCAAGGGCAAGGCAGCCACAGTGCAAGACGCCCGCGACGAAGAAGAATGA
Transcript >Ophun1|3883
ATGCCCAAGATGCGGCTCGGCTGGTACGCTGGGGTCTCCACGGCCCTCGCGGGCGGCGTCGTCATCTCGGCCTTT
CTCCAGCGGGCGAACTTTTATTCGGCCATGGTATACCTGGCCCAGAGCAACTTTTGCTTGCTGGCCCTGGTCAAC
TTTTCCCTCCTTCTTTACAGCAGTTTTATCTACGGTTTGACGCGCATATGTTTCGGTTCGCTTCGCGCCGTCGAG
GTCGAGCAACTCACAGAGAGAGCATGGTTCGCCATCACGGAAACGTGCCTCGCCATGACCATATTCAGAGAAGAA
ATAGGGGCCTGGTTCCTGGTTATGTTCACGGCGTTGGTGACGGGCAAGGTGTGGGGCTGGATTGGCGACGGCCGA
GTCGAGTTTCTTGAGCAGCAACCGCCTCACAACCCGCGGCTCTTCCACCTTCGCCTTAGTATTTCCCTCGGCATG
AGCTTCCTGTACGACATACTGATACTGCGATATTCGGTTCGGAACGTCATTCAGCAGGCACGTCCAAACATGATG
GTCATGTTTCTTTTTGAATTCGCGGTACTGGCTACGTGCTCGTGGCGCACAGGCGCTCGGTATATGCTCGTCTTG
GCGGAACAGAACATCATCAAGACGCAGACGAGGAAGAGGCTGTTTGAAAGAAGACTGGAAGTTCGGGAGCAGCGG
GAGGCCATTTTGCGACGGCGTGAGCAAGCCGCAGCCGCAGGAGAGGACGCAGCCGCCGATGACGAACCGTTGCCG
AACGAAGACGACGTCGACGAGATGGACATCGAAGTCCCCGGCTGGTCTGCTAAGGGGGAATGGGTGCTTTGGCTC
GATCTTCTCAGTGATATGATCAAGCTCAGCATCTATGTTGCCTTCTTCTTCATGCTCCTCATGTTCTACGGCTTG
CCCATTCACATTATGAGGGATCTGTTTATGACGTCTCGCGATTTCATCAAGAGACTAAACGCCCTATTGCGCTAT
CGCCGAGCTATACAGGAGATGAACCGATACCCAGATGCGTCCGCCGACGACCTTGCGCAGGAAAATACGTGCATC
ATCTGTCGAGAGGAGATGAGGCCGTGGGATCCGGTTGAAAACCCGGGCGCCATCGATCGGGTACGGCCAAAGAAG
TTGCCTTGCGGCCATATCCTGCACCTCGGCTGTCTCAAGAGCTGGCTTGAGCGGCAACAGGTGTGTCCCACATGC
AGGAGTCCCGTAACAGCCGCTCGAGCTCGCGGCCGTCCTGCAGCCGGAGCGGCCGGGCTCAGGATACAGATCGGG
GGCCAGCCGAGGCCACAAGGCCAGCAGCCGCCGGCGGACGTTGACCAGCAGGGTCAAGAGAACGACGATCCACAG
CCGAGGCCGCCAAGAGAGGGAGGCCCTCGTATATTCAACATCGGGCCCATCCGGCTTGGGTTCGGCACCAACGGC
CAGCAGTTCCGCGAGCTCGCCCAGCAGTTCGGCGTACCGCACATCGCCGGAAACCAGGCGGCTCCGGCTCCAGCC
GCCGAGCAGAACCAGCCGACATTGGCCGACAACCTCGGAAGCATCGCCAATCTCCTCCGACAGACGGAGCAACTA
CTCCAGCGTGAAGCGCAGCGGATGCACATCGCGCAACAGGAGCTTCAGATTGTCAGTCTGCTGATGGCCGAGTTG
CTGCGCCTACAGCAGCGCCGTCTGCAAACGCTGGAACAACCTCTGGCCGCGCAGCCTCCTCTCCAGCCCTGGCCA
CCGGCTGCCCATGGCTTGCCGATGAATCCGCCCTTCCCACCAGCCCAGCAGTTCCCAGTCCCCTCTCTGGGGATA
CAGCCTCAATACCCGGGCCTGCCGATACTCCCCGGAGCACCACCTCGCTCAGGGAGCCCGCTGATGGCCCGTCTC
GGCACTTCCGGTCCCACGGCGCCCATCCCGGCCGGCAGTGCAGACCTTCCGGAGGGACTGACGCTACCTCCTGGA
TGGTCGGTGGTGCCTCTCCAAAGGCTGGACGGTTCCCCAAGCTCAGCCTCGATGCCTCACCCGCCACAGGCGCCC
GGGCACGAAGGAGACGCCCCGACGAACTCGAGCCAAGCAGCCAACGAGGCCCCAGCATCCGTACCCTTTCCAGTC
GGAAGCCATCCCGCTCCCCCAGAACTCGCCGCCGATGAACCCCCTTCGACGGAAGCTCGCCAAACCGCCGAGCCA
GCTCCAGTCGTAGCCCCCAACCCCGTGATGCCCAACTGGGCCGGCCCATCGCAGCTACTAAACAACGGACCCCGC
GTCAACCCCGAAGAACCCGAGCGGCAGCCCGCCGAGTCTACAAGCACAGCCATGCCCACAACAACAACAGCAGCA
ACAGCAACAGCAGCAACAGCAACAGTCACAAGCGAGCATCCCGACACCGAAGGCGGACAAGAATCCCCCTCATCA
TCCAAGGGCAAGGGCAAGGCAGCCACAGTGCAAGACGCCCGCGACGAAGAAGAATGA
Gene >Ophun1|3883
ATGCCCAAGATGCGGCTCGGCTGGTACGCTGGGGTACGTATGCCGCAATTTCTGCTACTATGGCAATTCTTTGGC
TTCACCGTCTTCTTGCGAGGCTTGGGCTGACGGCGGGTCCAGGTCTCCACGGCCCTCGCGGGCGGCGTCGTCATC
TCGGCCTTTCTCCAGCGGGCGAACTTTTATTCGGCCATGGTATACCTGGCCCAGAGCAACTTTTGCTTGCTGGTA
AGTTGATATGCTCATTACTTCCCATCCGATGAGGCCGCAATAGCTGACGAGCGGTCCCCTGCCCAGGCCCTGGTC
AACTTTTCCCTCCTTCTTTACAGCAGTTTTATCTACGGTTTGACGCGCATATGTTTCGGTTCGCTTCGCGCCGTC
GAGGTCGAGCAACTCACAGAGAGAGCATGGTTCGCCATCACGGAAACGTGCCTCGCCATGACCATATTCAGAGAA
GAAATAGGGGCCTGGTTCCTGGTTATGTTCACGGCGTTGGTGACGGGCAAGGTGTGGGGCTGGATTGGCGACGGC
CGAGTCGAGTTTCTTGAGCAGCAACCGCCTCACAACCCGCGGCTCTTCCACCTTCGCCTTAGTATTTCCCTCGGC
ATGAGCTTCCTGTACGACATACTGATACTGCGATATTCGGTTCGGAACGTCATTCAGCAGGCACGTCCAAACATG
ATGGTCATGTTTCTTTTTGAATTCGCGGTACTGGCTACGTGCTCGTGGCGCACAGGCGCTCGGTATATGCTCGTC
TTGGCGGAACAGAACATCATCAAGACGCAGACGAGGAAGAGGCTGTTTGAAAGAAGACTGGAAGTTCGGGAGCAG
CGGGAGGCCATTTTGCGACGGCGTGAGCAAGCCGCAGCCGCAGGAGAGGACGCAGCCGCCGATGACGAACCGTTG
CCGAACGAAGACGACGTCGACGAGATGGACATCGAAGTCCCCGGCTGGTCTGCTAAGGGGGAATGGGTGCTTTGG
CTCGATCTTCTCAGTGGTAAGAGTTATTCGTCTCTCGAGGTCTCTGCGCGCGCCGCTGACAGTTTTGGCAGATAT
GATCAAGCTCAGCATCTATGTTGCCTTCTTCTTCATGCTCCTCATGTTCTACGGCTTGCCCATTCACATTATGAG
GGATCTGTTTATGACGTCTCGCGATTTCATCAAGAGACTAAACGCCCTATTGCGCTATCGCCGAGCTATACAGGA
GATGAACCGATACCCAGATGCGTCCGCCGACGACCTTGCGCAGGAAAATACGTGCATCATCTGTCGAGAGGAGAT
GAGGCCGTGGGATCCGGTTGAAAACCCGGGCGCCATCGATCGGGTACGGCCAAAGAAGTTGCCTTGCGGCCATAT
CCTGCACCTCGGCTGTCTCAAGAGCTGGCTTGAGCGGCAACAGGTGTGTCCCACATGCAGGAGTCCCGTAACAGC
CGCTCGAGCTCGCGGCCGTCCTGCAGCCGGAGCGGCCGGGCTCAGGATACAGATCGGGGGCCAGCCGAGGCCACA
AGGCCAGCAGCCGCCGGCGGACGTTGACCAGCAGGGTCAAGAGAACGACGATCCACAGCCGAGGCCGCCAAGAGA
GGGAGGCCCTCGTATATTCAACATCGGGCCCATCCGGCTTGGGTTCGGCACCAACGGCCAGCAGTTCCGCGAGCT
CGCCCAGCAGTTCGGCGTACCGCACATCGCCGGAAACCAGGCGGCTCCGGCTCCAGCCGCCGAGCAGAACCAGCC
GACATTGGCCGACAACCTCGGAAGCATCGCCAATCTCCTCCGACAGACGGAGCAACTACTCCAGCGTGAAGCGCA
GCGGATGCACATCGCGCAACAGGAGCTTCAGATTGTCAGTCTGCTGATGGCCGAGTTGCTGCGCCTACAGCAGCG
CCGTCTGCAAACGCTGGAACAACCTCTGGCCGCGCAGCCTCCTCTCCAGCCCTGGCCACCGGCTGCCCATGGCTT
GCCGATGAATCCGCCCTTCCCACCAGCCCAGCAGTTCCCAGTCCCCTCTCTGGGGATACAGCCTCAATACCCGGG
CCTGCCGATACTCCCCGGAGCACCACCTCGCTCAGGGAGCCCGCTGATGGCCCGTCTCGGCACTTCCGGTCCCAC
GGCGCCCATCCCGGCCGGCAGTGCAGACCTTCCGGAGGGACTGACGCTACCTCCTGGATGGTCGGTGGTGCCTCT
CCAAAGGCTGGACGGTTCCCCAAGCTCAGCCTCGATGCCTCACCCGCCACAGGCGCCCGGGCACGAAGGAGACGC
CCCGACGAACTCGAGCCAAGCAGCCAACGAGGCCCCAGCATCCGTACCCTTTCCAGTCGGAAGCCATCCCGCTCC
CCCAGAACTCGCCGCCGATGAACCCCCTTCGACGGAAGCTCGCCAAACCGCCGAGCCAGCTCCAGTCGTAGCCCC
CAACCCCGTGATGCCCAACTGGGCCGGCCCATCGCAGCTACTAAACAACGGACCCCGCGTCAACCCCGAAGAACC
CGAGCGGCAGCCCGCCGAGTCTACAAGCACAGCCATGCCCACAACAACAACAGCAGCAACAGCAACAGCAGCAAC
AGCAACAGTCACAAGCGAGCATCCCGACACCGAAGGCGGACAAGAATCCCCCTCATCATCCAAGGGCAAGGGCAA
GGCAGCCACAGTGCAAGACGCCCGCGACGAAGAAGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail