Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3883
Gene name
LocationContig_35:46142..48807
Strand-
Gene length (bp)2665
Transcript length (bp)2457
Coding sequence length (bp)2457
Protein length (aa) 819

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12678 zf-rbx1 RING-H2 zinc finger domain 2.2E-09 348 401
PF13639 zf-RING_2 Ring finger domain 5.6E-08 347 401
PF13445 zf-RING_UBOX RING-type zinc-finger 1.4E-05 349 398
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 2.8E-05 349 400

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5Z880|HRD1_ORYSJ ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Oryza sativa subsp. japonica GN=HRD1 PE=2 SV=1 4 438 3.0E-65
sp|Q95SP2|HRD1_DROME E3 ubiquitin-protein ligase HRD1 OS=Drosophila melanogaster GN=sip3 PE=1 SV=1 10 443 9.0E-57
sp|A8Y4B2|HRD1_CAEBR E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis briggsae GN=sel-11 PE=3 SV=2 3 408 2.0E-48
sp|O74757|HRD1_SCHPO ERAD-associated E3 ubiquitin-protein ligase hrd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrd1 PE=1 SV=1 4 463 4.0E-40
sp|Q6NPT7|HRD1B_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1B OS=Arabidopsis thaliana GN=HRD1B PE=2 SV=1 265 419 3.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5Z880|HRD1_ORYSJ ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Oryza sativa subsp. japonica GN=HRD1 PE=2 SV=1 4 438 3.0E-65
sp|Q95SP2|HRD1_DROME E3 ubiquitin-protein ligase HRD1 OS=Drosophila melanogaster GN=sip3 PE=1 SV=1 10 443 9.0E-57
sp|A8Y4B2|HRD1_CAEBR E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis briggsae GN=sel-11 PE=3 SV=2 3 408 2.0E-48
sp|O74757|HRD1_SCHPO ERAD-associated E3 ubiquitin-protein ligase hrd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrd1 PE=1 SV=1 4 463 4.0E-40
sp|Q6NPT7|HRD1B_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1B OS=Arabidopsis thaliana GN=HRD1B PE=2 SV=1 265 419 3.0E-36
sp|Q9LW77|HRD1A_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1A OS=Arabidopsis thaliana GN=HRD1A PE=2 SV=1 259 405 6.0E-36
sp|Q9LW77|HRD1A_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1A OS=Arabidopsis thaliana GN=HRD1A PE=2 SV=1 4 202 8.0E-28
sp|Q6NRL6|SYVNA_XENLA E3 ubiquitin-protein ligase synoviolin A OS=Xenopus laevis GN=syvn1-a PE=2 SV=1 265 413 1.0E-27
sp|Q5XHH7|SYVNB_XENLA E3 ubiquitin-protein ligase synoviolin B OS=Xenopus laevis GN=syvn1-b PE=2 SV=1 265 413 4.0E-27
sp|Q803I8|SYVN1_DANRE E3 ubiquitin-protein ligase synoviolin OS=Danio rerio GN=syvn1 PE=2 SV=2 265 407 6.0E-27
sp|Q803I8|SYVN1_DANRE E3 ubiquitin-protein ligase synoviolin OS=Danio rerio GN=syvn1 PE=2 SV=2 4 198 1.0E-26
sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=Mus musculus GN=Syvn1 PE=1 SV=3 4 198 2.0E-26
sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens GN=SYVN1 PE=1 SV=2 265 407 3.0E-26
sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens GN=SYVN1 PE=1 SV=2 4 198 4.0E-26
sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=Mus musculus GN=Syvn1 PE=1 SV=3 265 407 5.0E-26
sp|Q5XHH7|SYVNB_XENLA E3 ubiquitin-protein ligase synoviolin B OS=Xenopus laevis GN=syvn1-b PE=2 SV=1 11 198 2.0E-25
sp|Q6NRL6|SYVNA_XENLA E3 ubiquitin-protein ligase synoviolin A OS=Xenopus laevis GN=syvn1-a PE=2 SV=1 10 198 2.0E-25
sp|Q6NPT7|HRD1B_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1B OS=Arabidopsis thaliana GN=HRD1B PE=2 SV=1 4 196 3.0E-25
sp|Q20798|HRD1_CAEEL E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis elegans GN=sel-11 PE=3 SV=1 7 198 9.0E-24
sp|Q20798|HRD1_CAEEL E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis elegans GN=sel-11 PE=3 SV=1 264 408 8.0E-23
sp|Q75CC8|HRD1_ASHGO ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HRD1 PE=3 SV=2 36 417 7.0E-20
sp|Q08109|HRD1_YEAST ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRD1 PE=1 SV=1 3 404 3.0E-18
sp|Q8VYC8|RIN2_ARATH E3 ubiquitin protein ligase RIN2 OS=Arabidopsis thaliana GN=RIN2 PE=1 SV=1 34 409 2.0E-17
sp|Q9UKV5|AMFR_HUMAN E3 ubiquitin-protein ligase AMFR OS=Homo sapiens GN=AMFR PE=1 SV=2 265 407 2.0E-12
sp|Q9R049|AMFR_MOUSE E3 ubiquitin-protein ligase AMFR OS=Mus musculus GN=Amfr PE=1 SV=2 265 410 2.0E-12
sp|Q8W4Q5|RIN3_ARATH E3 ubiquitin protein ligase RIN3 OS=Arabidopsis thaliana GN=RIN3 PE=1 SV=2 21 409 2.0E-09
sp|Q96MT1|RN145_HUMAN RING finger protein 145 OS=Homo sapiens GN=RNF145 PE=2 SV=2 322 458 6.0E-08
sp|Q5SWK7|RN145_MOUSE RING finger protein 145 OS=Mus musculus GN=Rnf145 PE=2 SV=1 246 450 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0046914 transition metal ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 41 63 22
3 102 124 22
4 139 161 22
5 284 306 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5221
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7995
Ophiocordyceps australis map64 (Brazil) OphauB2|4069
Ophiocordyceps camponoti-floridani Ophcf2|06098
Ophiocordyceps camponoti-rufipedis Ophun1|3883 (this protein)
Ophiocordyceps kimflemingae Ophio5|225
Ophiocordyceps subramaniannii Hirsu2|4226

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3883
MPKMRLGWYAGVSTALAGGVVISAFLQRANFYSAMVYLAQSNFCLLALVNFSLLLYSSFIYGLTRICFGSLRAVE
VEQLTERAWFAITETCLAMTIFREEIGAWFLVMFTALVTGKVWGWIGDGRVEFLEQQPPHNPRLFHLRLSISLGM
SFLYDILILRYSVRNVIQQARPNMMVMFLFEFAVLATCSWRTGARYMLVLAEQNIIKTQTRKRLFERRLEVREQR
EAILRRREQAAAAGEDAAADDEPLPNEDDVDEMDIEVPGWSAKGEWVLWLDLLSDMIKLSIYVAFFFMLLMFYGL
PIHIMRDLFMTSRDFIKRLNALLRYRRAIQEMNRYPDASADDLAQENTCIICREEMRPWDPVENPGAIDRVRPKK
LPCGHILHLGCLKSWLERQQVCPTCRSPVTAARARGRPAAGAAGLRIQIGGQPRPQGQQPPADVDQQGQENDDPQ
PRPPREGGPRIFNIGPIRLGFGTNGQQFRELAQQFGVPHIAGNQAAPAPAAEQNQPTLADNLGSIANLLRQTEQL
LQREAQRMHIAQQELQIVSLLMAELLRLQQRRLQTLEQPLAAQPPLQPWPPAAHGLPMNPPFPPAQQFPVPSLGI
QPQYPGLPILPGAPPRSGSPLMARLGTSGPTAPIPAGSADLPEGLTLPPGWSVVPLQRLDGSPSSASMPHPPQAP
GHEGDAPTNSSQAANEAPASVPFPVGSHPAPPELAADEPPSTEARQTAEPAPVVAPNPVMPNWAGPSQLLNNGPR
VNPEEPERQPAESTSTAMPTTTTAATATAATATVTSEHPDTEGGQESPSSSKGKGKAATVQDARDEEE*
Coding >Ophun1|3883
ATGCCCAAGATGCGGCTCGGCTGGTACGCTGGGGTCTCCACGGCCCTCGCGGGCGGCGTCGTCATCTCGGCCTTT
CTCCAGCGGGCGAACTTTTATTCGGCCATGGTATACCTGGCCCAGAGCAACTTTTGCTTGCTGGCCCTGGTCAAC
TTTTCCCTCCTTCTTTACAGCAGTTTTATCTACGGTTTGACGCGCATATGTTTCGGTTCGCTTCGCGCCGTCGAG
GTCGAGCAACTCACAGAGAGAGCATGGTTCGCCATCACGGAAACGTGCCTCGCCATGACCATATTCAGAGAAGAA
ATAGGGGCCTGGTTCCTGGTTATGTTCACGGCGTTGGTGACGGGCAAGGTGTGGGGCTGGATTGGCGACGGCCGA
GTCGAGTTTCTTGAGCAGCAACCGCCTCACAACCCGCGGCTCTTCCACCTTCGCCTTAGTATTTCCCTCGGCATG
AGCTTCCTGTACGACATACTGATACTGCGATATTCGGTTCGGAACGTCATTCAGCAGGCACGTCCAAACATGATG
GTCATGTTTCTTTTTGAATTCGCGGTACTGGCTACGTGCTCGTGGCGCACAGGCGCTCGGTATATGCTCGTCTTG
GCGGAACAGAACATCATCAAGACGCAGACGAGGAAGAGGCTGTTTGAAAGAAGACTGGAAGTTCGGGAGCAGCGG
GAGGCCATTTTGCGACGGCGTGAGCAAGCCGCAGCCGCAGGAGAGGACGCAGCCGCCGATGACGAACCGTTGCCG
AACGAAGACGACGTCGACGAGATGGACATCGAAGTCCCCGGCTGGTCTGCTAAGGGGGAATGGGTGCTTTGGCTC
GATCTTCTCAGTGATATGATCAAGCTCAGCATCTATGTTGCCTTCTTCTTCATGCTCCTCATGTTCTACGGCTTG
CCCATTCACATTATGAGGGATCTGTTTATGACGTCTCGCGATTTCATCAAGAGACTAAACGCCCTATTGCGCTAT
CGCCGAGCTATACAGGAGATGAACCGATACCCAGATGCGTCCGCCGACGACCTTGCGCAGGAAAATACGTGCATC
ATCTGTCGAGAGGAGATGAGGCCGTGGGATCCGGTTGAAAACCCGGGCGCCATCGATCGGGTACGGCCAAAGAAG
TTGCCTTGCGGCCATATCCTGCACCTCGGCTGTCTCAAGAGCTGGCTTGAGCGGCAACAGGTGTGTCCCACATGC
AGGAGTCCCGTAACAGCCGCTCGAGCTCGCGGCCGTCCTGCAGCCGGAGCGGCCGGGCTCAGGATACAGATCGGG
GGCCAGCCGAGGCCACAAGGCCAGCAGCCGCCGGCGGACGTTGACCAGCAGGGTCAAGAGAACGACGATCCACAG
CCGAGGCCGCCAAGAGAGGGAGGCCCTCGTATATTCAACATCGGGCCCATCCGGCTTGGGTTCGGCACCAACGGC
CAGCAGTTCCGCGAGCTCGCCCAGCAGTTCGGCGTACCGCACATCGCCGGAAACCAGGCGGCTCCGGCTCCAGCC
GCCGAGCAGAACCAGCCGACATTGGCCGACAACCTCGGAAGCATCGCCAATCTCCTCCGACAGACGGAGCAACTA
CTCCAGCGTGAAGCGCAGCGGATGCACATCGCGCAACAGGAGCTTCAGATTGTCAGTCTGCTGATGGCCGAGTTG
CTGCGCCTACAGCAGCGCCGTCTGCAAACGCTGGAACAACCTCTGGCCGCGCAGCCTCCTCTCCAGCCCTGGCCA
CCGGCTGCCCATGGCTTGCCGATGAATCCGCCCTTCCCACCAGCCCAGCAGTTCCCAGTCCCCTCTCTGGGGATA
CAGCCTCAATACCCGGGCCTGCCGATACTCCCCGGAGCACCACCTCGCTCAGGGAGCCCGCTGATGGCCCGTCTC
GGCACTTCCGGTCCCACGGCGCCCATCCCGGCCGGCAGTGCAGACCTTCCGGAGGGACTGACGCTACCTCCTGGA
TGGTCGGTGGTGCCTCTCCAAAGGCTGGACGGTTCCCCAAGCTCAGCCTCGATGCCTCACCCGCCACAGGCGCCC
GGGCACGAAGGAGACGCCCCGACGAACTCGAGCCAAGCAGCCAACGAGGCCCCAGCATCCGTACCCTTTCCAGTC
GGAAGCCATCCCGCTCCCCCAGAACTCGCCGCCGATGAACCCCCTTCGACGGAAGCTCGCCAAACCGCCGAGCCA
GCTCCAGTCGTAGCCCCCAACCCCGTGATGCCCAACTGGGCCGGCCCATCGCAGCTACTAAACAACGGACCCCGC
GTCAACCCCGAAGAACCCGAGCGGCAGCCCGCCGAGTCTACAAGCACAGCCATGCCCACAACAACAACAGCAGCA
ACAGCAACAGCAGCAACAGCAACAGTCACAAGCGAGCATCCCGACACCGAAGGCGGACAAGAATCCCCCTCATCA
TCCAAGGGCAAGGGCAAGGCAGCCACAGTGCAAGACGCCCGCGACGAAGAAGAATGA
Transcript >Ophun1|3883
ATGCCCAAGATGCGGCTCGGCTGGTACGCTGGGGTCTCCACGGCCCTCGCGGGCGGCGTCGTCATCTCGGCCTTT
CTCCAGCGGGCGAACTTTTATTCGGCCATGGTATACCTGGCCCAGAGCAACTTTTGCTTGCTGGCCCTGGTCAAC
TTTTCCCTCCTTCTTTACAGCAGTTTTATCTACGGTTTGACGCGCATATGTTTCGGTTCGCTTCGCGCCGTCGAG
GTCGAGCAACTCACAGAGAGAGCATGGTTCGCCATCACGGAAACGTGCCTCGCCATGACCATATTCAGAGAAGAA
ATAGGGGCCTGGTTCCTGGTTATGTTCACGGCGTTGGTGACGGGCAAGGTGTGGGGCTGGATTGGCGACGGCCGA
GTCGAGTTTCTTGAGCAGCAACCGCCTCACAACCCGCGGCTCTTCCACCTTCGCCTTAGTATTTCCCTCGGCATG
AGCTTCCTGTACGACATACTGATACTGCGATATTCGGTTCGGAACGTCATTCAGCAGGCACGTCCAAACATGATG
GTCATGTTTCTTTTTGAATTCGCGGTACTGGCTACGTGCTCGTGGCGCACAGGCGCTCGGTATATGCTCGTCTTG
GCGGAACAGAACATCATCAAGACGCAGACGAGGAAGAGGCTGTTTGAAAGAAGACTGGAAGTTCGGGAGCAGCGG
GAGGCCATTTTGCGACGGCGTGAGCAAGCCGCAGCCGCAGGAGAGGACGCAGCCGCCGATGACGAACCGTTGCCG
AACGAAGACGACGTCGACGAGATGGACATCGAAGTCCCCGGCTGGTCTGCTAAGGGGGAATGGGTGCTTTGGCTC
GATCTTCTCAGTGATATGATCAAGCTCAGCATCTATGTTGCCTTCTTCTTCATGCTCCTCATGTTCTACGGCTTG
CCCATTCACATTATGAGGGATCTGTTTATGACGTCTCGCGATTTCATCAAGAGACTAAACGCCCTATTGCGCTAT
CGCCGAGCTATACAGGAGATGAACCGATACCCAGATGCGTCCGCCGACGACCTTGCGCAGGAAAATACGTGCATC
ATCTGTCGAGAGGAGATGAGGCCGTGGGATCCGGTTGAAAACCCGGGCGCCATCGATCGGGTACGGCCAAAGAAG
TTGCCTTGCGGCCATATCCTGCACCTCGGCTGTCTCAAGAGCTGGCTTGAGCGGCAACAGGTGTGTCCCACATGC
AGGAGTCCCGTAACAGCCGCTCGAGCTCGCGGCCGTCCTGCAGCCGGAGCGGCCGGGCTCAGGATACAGATCGGG
GGCCAGCCGAGGCCACAAGGCCAGCAGCCGCCGGCGGACGTTGACCAGCAGGGTCAAGAGAACGACGATCCACAG
CCGAGGCCGCCAAGAGAGGGAGGCCCTCGTATATTCAACATCGGGCCCATCCGGCTTGGGTTCGGCACCAACGGC
CAGCAGTTCCGCGAGCTCGCCCAGCAGTTCGGCGTACCGCACATCGCCGGAAACCAGGCGGCTCCGGCTCCAGCC
GCCGAGCAGAACCAGCCGACATTGGCCGACAACCTCGGAAGCATCGCCAATCTCCTCCGACAGACGGAGCAACTA
CTCCAGCGTGAAGCGCAGCGGATGCACATCGCGCAACAGGAGCTTCAGATTGTCAGTCTGCTGATGGCCGAGTTG
CTGCGCCTACAGCAGCGCCGTCTGCAAACGCTGGAACAACCTCTGGCCGCGCAGCCTCCTCTCCAGCCCTGGCCA
CCGGCTGCCCATGGCTTGCCGATGAATCCGCCCTTCCCACCAGCCCAGCAGTTCCCAGTCCCCTCTCTGGGGATA
CAGCCTCAATACCCGGGCCTGCCGATACTCCCCGGAGCACCACCTCGCTCAGGGAGCCCGCTGATGGCCCGTCTC
GGCACTTCCGGTCCCACGGCGCCCATCCCGGCCGGCAGTGCAGACCTTCCGGAGGGACTGACGCTACCTCCTGGA
TGGTCGGTGGTGCCTCTCCAAAGGCTGGACGGTTCCCCAAGCTCAGCCTCGATGCCTCACCCGCCACAGGCGCCC
GGGCACGAAGGAGACGCCCCGACGAACTCGAGCCAAGCAGCCAACGAGGCCCCAGCATCCGTACCCTTTCCAGTC
GGAAGCCATCCCGCTCCCCCAGAACTCGCCGCCGATGAACCCCCTTCGACGGAAGCTCGCCAAACCGCCGAGCCA
GCTCCAGTCGTAGCCCCCAACCCCGTGATGCCCAACTGGGCCGGCCCATCGCAGCTACTAAACAACGGACCCCGC
GTCAACCCCGAAGAACCCGAGCGGCAGCCCGCCGAGTCTACAAGCACAGCCATGCCCACAACAACAACAGCAGCA
ACAGCAACAGCAGCAACAGCAACAGTCACAAGCGAGCATCCCGACACCGAAGGCGGACAAGAATCCCCCTCATCA
TCCAAGGGCAAGGGCAAGGCAGCCACAGTGCAAGACGCCCGCGACGAAGAAGAATGA
Gene >Ophun1|3883
ATGCCCAAGATGCGGCTCGGCTGGTACGCTGGGGTACGTATGCCGCAATTTCTGCTACTATGGCAATTCTTTGGC
TTCACCGTCTTCTTGCGAGGCTTGGGCTGACGGCGGGTCCAGGTCTCCACGGCCCTCGCGGGCGGCGTCGTCATC
TCGGCCTTTCTCCAGCGGGCGAACTTTTATTCGGCCATGGTATACCTGGCCCAGAGCAACTTTTGCTTGCTGGTA
AGTTGATATGCTCATTACTTCCCATCCGATGAGGCCGCAATAGCTGACGAGCGGTCCCCTGCCCAGGCCCTGGTC
AACTTTTCCCTCCTTCTTTACAGCAGTTTTATCTACGGTTTGACGCGCATATGTTTCGGTTCGCTTCGCGCCGTC
GAGGTCGAGCAACTCACAGAGAGAGCATGGTTCGCCATCACGGAAACGTGCCTCGCCATGACCATATTCAGAGAA
GAAATAGGGGCCTGGTTCCTGGTTATGTTCACGGCGTTGGTGACGGGCAAGGTGTGGGGCTGGATTGGCGACGGC
CGAGTCGAGTTTCTTGAGCAGCAACCGCCTCACAACCCGCGGCTCTTCCACCTTCGCCTTAGTATTTCCCTCGGC
ATGAGCTTCCTGTACGACATACTGATACTGCGATATTCGGTTCGGAACGTCATTCAGCAGGCACGTCCAAACATG
ATGGTCATGTTTCTTTTTGAATTCGCGGTACTGGCTACGTGCTCGTGGCGCACAGGCGCTCGGTATATGCTCGTC
TTGGCGGAACAGAACATCATCAAGACGCAGACGAGGAAGAGGCTGTTTGAAAGAAGACTGGAAGTTCGGGAGCAG
CGGGAGGCCATTTTGCGACGGCGTGAGCAAGCCGCAGCCGCAGGAGAGGACGCAGCCGCCGATGACGAACCGTTG
CCGAACGAAGACGACGTCGACGAGATGGACATCGAAGTCCCCGGCTGGTCTGCTAAGGGGGAATGGGTGCTTTGG
CTCGATCTTCTCAGTGGTAAGAGTTATTCGTCTCTCGAGGTCTCTGCGCGCGCCGCTGACAGTTTTGGCAGATAT
GATCAAGCTCAGCATCTATGTTGCCTTCTTCTTCATGCTCCTCATGTTCTACGGCTTGCCCATTCACATTATGAG
GGATCTGTTTATGACGTCTCGCGATTTCATCAAGAGACTAAACGCCCTATTGCGCTATCGCCGAGCTATACAGGA
GATGAACCGATACCCAGATGCGTCCGCCGACGACCTTGCGCAGGAAAATACGTGCATCATCTGTCGAGAGGAGAT
GAGGCCGTGGGATCCGGTTGAAAACCCGGGCGCCATCGATCGGGTACGGCCAAAGAAGTTGCCTTGCGGCCATAT
CCTGCACCTCGGCTGTCTCAAGAGCTGGCTTGAGCGGCAACAGGTGTGTCCCACATGCAGGAGTCCCGTAACAGC
CGCTCGAGCTCGCGGCCGTCCTGCAGCCGGAGCGGCCGGGCTCAGGATACAGATCGGGGGCCAGCCGAGGCCACA
AGGCCAGCAGCCGCCGGCGGACGTTGACCAGCAGGGTCAAGAGAACGACGATCCACAGCCGAGGCCGCCAAGAGA
GGGAGGCCCTCGTATATTCAACATCGGGCCCATCCGGCTTGGGTTCGGCACCAACGGCCAGCAGTTCCGCGAGCT
CGCCCAGCAGTTCGGCGTACCGCACATCGCCGGAAACCAGGCGGCTCCGGCTCCAGCCGCCGAGCAGAACCAGCC
GACATTGGCCGACAACCTCGGAAGCATCGCCAATCTCCTCCGACAGACGGAGCAACTACTCCAGCGTGAAGCGCA
GCGGATGCACATCGCGCAACAGGAGCTTCAGATTGTCAGTCTGCTGATGGCCGAGTTGCTGCGCCTACAGCAGCG
CCGTCTGCAAACGCTGGAACAACCTCTGGCCGCGCAGCCTCCTCTCCAGCCCTGGCCACCGGCTGCCCATGGCTT
GCCGATGAATCCGCCCTTCCCACCAGCCCAGCAGTTCCCAGTCCCCTCTCTGGGGATACAGCCTCAATACCCGGG
CCTGCCGATACTCCCCGGAGCACCACCTCGCTCAGGGAGCCCGCTGATGGCCCGTCTCGGCACTTCCGGTCCCAC
GGCGCCCATCCCGGCCGGCAGTGCAGACCTTCCGGAGGGACTGACGCTACCTCCTGGATGGTCGGTGGTGCCTCT
CCAAAGGCTGGACGGTTCCCCAAGCTCAGCCTCGATGCCTCACCCGCCACAGGCGCCCGGGCACGAAGGAGACGC
CCCGACGAACTCGAGCCAAGCAGCCAACGAGGCCCCAGCATCCGTACCCTTTCCAGTCGGAAGCCATCCCGCTCC
CCCAGAACTCGCCGCCGATGAACCCCCTTCGACGGAAGCTCGCCAAACCGCCGAGCCAGCTCCAGTCGTAGCCCC
CAACCCCGTGATGCCCAACTGGGCCGGCCCATCGCAGCTACTAAACAACGGACCCCGCGTCAACCCCGAAGAACC
CGAGCGGCAGCCCGCCGAGTCTACAAGCACAGCCATGCCCACAACAACAACAGCAGCAACAGCAACAGCAGCAAC
AGCAACAGTCACAAGCGAGCATCCCGACACCGAAGGCGGACAAGAATCCCCCTCATCATCCAAGGGCAAGGGCAA
GGCAGCCACAGTGCAAGACGCCCGCGACGAAGAAGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail