Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3880
Gene name
LocationContig_35:38288..39569
Strand+
Gene length (bp)1281
Transcript length (bp)1281
Coding sequence length (bp)1281
Protein length (aa) 427

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01545 Cation_efflux Cation efflux family 4.1E-18 142 330
PF16916 ZT_dimer Dimerisation domain of Zinc Transporter 1.4E-10 349 411

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Z7K5|MTP3_ORYSJ Metal tolerance protein 3 OS=Oryza sativa subsp. japonica GN=MTP3 PE=2 SV=1 82 420 9.0E-61
sp|Q10PP8|MTP4_ORYSJ Metal tolerance protein 4 OS=Oryza sativa subsp. japonica GN=MTP4 PE=2 SV=1 100 426 6.0E-57
sp|Q5NA18|MTP5_ORYSJ Metal tolerance protein 5 OS=Oryza sativa subsp. japonica GN=MTP5 PE=2 SV=1 137 425 1.0E-53
sp|Q0WU02|MTP10_ARATH Metal tolerance protein 10 OS=Arabidopsis thaliana GN=MTP10 PE=2 SV=1 94 422 1.0E-52
sp|Q9SAJ7|MTP9_ARATH Metal tolerance protein 9 OS=Arabidopsis thaliana GN=MTP9 PE=2 SV=2 69 422 2.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Z7K5|MTP3_ORYSJ Metal tolerance protein 3 OS=Oryza sativa subsp. japonica GN=MTP3 PE=2 SV=1 82 420 9.0E-61
sp|Q10PP8|MTP4_ORYSJ Metal tolerance protein 4 OS=Oryza sativa subsp. japonica GN=MTP4 PE=2 SV=1 100 426 6.0E-57
sp|Q5NA18|MTP5_ORYSJ Metal tolerance protein 5 OS=Oryza sativa subsp. japonica GN=MTP5 PE=2 SV=1 137 425 1.0E-53
sp|Q0WU02|MTP10_ARATH Metal tolerance protein 10 OS=Arabidopsis thaliana GN=MTP10 PE=2 SV=1 94 422 1.0E-52
sp|Q9SAJ7|MTP9_ARATH Metal tolerance protein 9 OS=Arabidopsis thaliana GN=MTP9 PE=2 SV=2 69 422 2.0E-52
sp|Q9M2P2|MTPC3_ARATH Putative metal tolerance protein C3 OS=Arabidopsis thaliana GN=MTPC3 PE=3 SV=2 145 423 5.0E-51
sp|Q9LDU0|MTP7_ORYSJ Metal tolerance protein 7 OS=Oryza sativa subsp. japonica GN=MTP7 PE=2 SV=1 91 422 4.0E-50
sp|O80632|MTP11_ARATH Metal tolerance protein 11 OS=Arabidopsis thaliana GN=MTP11 PE=2 SV=1 93 421 3.0E-38
sp|Q0DHJ5|MTP6_ORYSJ Metal tolerance protein 6 OS=Oryza sativa subsp. japonica GN=MTP6 PE=2 SV=2 68 421 4.0E-33
sp|Q57891|Y449_METJA Uncharacterized transporter MJ0449 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0449 PE=3 SV=1 162 411 2.0E-09
sp|B5XZ41|FIEF_KLEP3 Cation-efflux pump FieF OS=Klebsiella pneumoniae (strain 342) GN=fieF PE=3 SV=1 152 401 2.0E-08
sp|Q6CZ45|FIEF_PECAS Cation-efflux pump FieF OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fieF PE=3 SV=1 137 397 4.0E-08
sp|A8AL14|FIEF_CITK8 Cation-efflux pump FieF OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fieF PE=3 SV=1 131 401 8.0E-08
sp|Q8RR17|FIEF_KLEPN Cation-efflux pump FieF OS=Klebsiella pneumoniae GN=fieF PE=3 SV=1 152 401 2.0E-07
sp|A6TGB7|FIEF_KLEP7 Cation-efflux pump FieF OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fieF PE=3 SV=1 152 401 2.0E-07
sp|Q57HF4|FIEF_SALCH Cation-efflux pump FieF OS=Salmonella choleraesuis (strain SC-B67) GN=fieF PE=3 SV=1 131 401 5.0E-07
sp|Q8L725|MTPC1_ARATH Metal tolerance protein C1 OS=Arabidopsis thaliana GN=MTPC1 PE=2 SV=1 119 411 8.0E-07
sp|A9MI51|FIEF_SALAR Cation-efflux pump FieF OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=fieF PE=3 SV=1 152 401 3.0E-06
sp|C6DHK1|FIEF_PECCP Cation-efflux pump FieF OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=fieF PE=3 SV=1 137 404 3.0E-06
sp|Q8ZKR4|FIEF_SALTY Cation-efflux pump FieF OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fieF PE=3 SV=1 152 401 3.0E-06
sp|C0Q413|FIEF_SALPC Cation-efflux pump FieF OS=Salmonella paratyphi C (strain RKS4594) GN=fieF PE=3 SV=1 152 401 3.0E-06
sp|A9MZE6|FIEF_SALPB Cation-efflux pump FieF OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fieF PE=3 SV=1 152 401 3.0E-06
sp|B4T048|FIEF_SALNS Cation-efflux pump FieF OS=Salmonella newport (strain SL254) GN=fieF PE=3 SV=1 152 401 3.0E-06
sp|B4TCJ9|FIEF_SALHS Cation-efflux pump FieF OS=Salmonella heidelberg (strain SL476) GN=fieF PE=3 SV=1 152 401 3.0E-06
sp|B5RFB0|FIEF_SALG2 Cation-efflux pump FieF OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=fieF PE=3 SV=1 152 401 3.0E-06
sp|B5QWZ4|FIEF_SALEP Cation-efflux pump FieF OS=Salmonella enteritidis PT4 (strain P125109) GN=fieF PE=3 SV=1 152 401 3.0E-06
sp|B5FPR1|FIEF_SALDC Cation-efflux pump FieF OS=Salmonella dublin (strain CT_02021853) GN=fieF PE=3 SV=1 152 401 3.0E-06
sp|B4TPS5|FIEF_SALSV Cation-efflux pump FieF OS=Salmonella schwarzengrund (strain CVM19633) GN=fieF PE=3 SV=1 152 401 4.0E-06
sp|P96610|YDBO_BACSU Uncharacterized transporter YdbO OS=Bacillus subtilis (strain 168) GN=ydbO PE=3 SV=1 127 398 7.0E-06
sp|P21559|P34_RICRS Protein p34 OS=Rickettsia rickettsii (strain Sheila Smith) GN=p34 PE=3 SV=1 138 404 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0006812 cation transport Yes
GO:0008324 cation transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0006811 ion transport No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0005215 transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 135 157 22
2 172 189 17
3 210 232 22
4 242 264 22
5 283 302 19
6 312 334 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3880
MSSSSHGTSPVRLKAMTTTPLERIASQTTDVESQTTTSRQTPTPVLNDPYNLTSRFKSASDLNRIDNRSARTRLG
SLIRRLRPHTDDETIGPRRSARKVRGFYEKQNAAIERMLKPVEEHRADARREQGDNQLKYRIAVYGSLAANVVLA
GLQLYAAISSGSLSLFATMADAIFDPLSALTLILSSRAIERVDPRRFPAGKARLETVGNIVFCFLMISVSLVIIA
LAAQQLIQKRSDEEFHLASIISVCAAFATKLALFLFCWTIKDRYSQVKILWQDHRNDLFVNAFGILTAVGGARLE
WWIDPAGAITLSIIISAVWLRTSFAEFLLLVGVVPSVETQQLLTYVSLTHSPMIREIDTMRAYYSGPRLIVEVDV
VMDSTVTLAESHDVAEDLQCKLESLPEVERAYVHIDYETTHKPEHACLKEM*
Coding >Ophun1|3880
ATGTCATCGTCCAGTCACGGCACGTCGCCAGTCCGTCTCAAGGCCATGACGACAACACCGCTGGAGCGCATCGCC
TCGCAGACAACCGACGTCGAAAGCCAGACGACAACCAGCCGTCAAACACCCACGCCCGTCCTCAACGATCCCTAC
AACCTGACATCCCGCTTCAAGTCGGCCTCGGACCTGAACCGCATCGACAACAGATCCGCTCGCACGAGACTCGGC
AGCCTCATCCGACGCCTTCGTCCGCATACCGATGATGAGACCATCGGCCCTCGGCGCAGTGCCCGAAAGGTGCGC
GGCTTCTACGAGAAGCAGAACGCTGCCATCGAGCGGATGCTCAAGCCCGTAGAAGAGCACCGCGCAGACGCCCGT
CGAGAACAGGGCGACAACCAGCTCAAGTATCGCATAGCCGTCTACGGCTCTCTGGCCGCCAATGTCGTTCTGGCG
GGCCTCCAGCTTTACGCTGCCATTTCATCTGGCTCCTTATCGCTGTTCGCCACCATGGCCGACGCCATCTTCGAT
CCGCTCAGCGCCTTGACTCTCATTCTGTCGAGTCGGGCTATCGAGCGTGTCGACCCGAGACGCTTTCCGGCTGGC
AAGGCGCGTCTTGAAACGGTTGGGAACATCGTCTTTTGCTTTCTCATGATATCCGTCTCGCTCGTCATCATTGCT
CTCGCAGCGCAGCAACTCATCCAGAAGAGATCCGACGAGGAATTCCACTTGGCGTCCATCATCTCCGTCTGCGCC
GCTTTTGCCACGAAGCTTGCGCTCTTCCTGTTCTGCTGGACCATCAAGGACCGCTACAGCCAGGTCAAGATCCTA
TGGCAGGACCACCGCAACGACTTGTTCGTCAACGCCTTCGGCATCCTGACTGCCGTGGGCGGCGCACGGCTGGAG
TGGTGGATCGACCCAGCTGGTGCCATCACGCTGTCCATCATCATCTCAGCTGTCTGGCTTCGCACCTCGTTCGCC
GAGTTTCTCTTGCTGGTGGGCGTGGTGCCATCAGTCGAGACGCAGCAGCTGCTCACTTACGTATCTCTGACGCAC
TCGCCCATGATCCGAGAGATCGACACGATGCGGGCCTATTACTCGGGCCCGCGGCTTATCGTCGAAGTCGACGTC
GTCATGGACTCGACCGTAACCCTGGCCGAGTCACACGACGTGGCTGAGGACCTGCAGTGCAAGCTGGAGAGTCTT
CCCGAGGTGGAGCGGGCGTACGTTCACATTGACTATGAGACGACGCACAAGCCTGAGCACGCGTGTCTGAAGGAG
ATGTGA
Transcript >Ophun1|3880
ATGTCATCGTCCAGTCACGGCACGTCGCCAGTCCGTCTCAAGGCCATGACGACAACACCGCTGGAGCGCATCGCC
TCGCAGACAACCGACGTCGAAAGCCAGACGACAACCAGCCGTCAAACACCCACGCCCGTCCTCAACGATCCCTAC
AACCTGACATCCCGCTTCAAGTCGGCCTCGGACCTGAACCGCATCGACAACAGATCCGCTCGCACGAGACTCGGC
AGCCTCATCCGACGCCTTCGTCCGCATACCGATGATGAGACCATCGGCCCTCGGCGCAGTGCCCGAAAGGTGCGC
GGCTTCTACGAGAAGCAGAACGCTGCCATCGAGCGGATGCTCAAGCCCGTAGAAGAGCACCGCGCAGACGCCCGT
CGAGAACAGGGCGACAACCAGCTCAAGTATCGCATAGCCGTCTACGGCTCTCTGGCCGCCAATGTCGTTCTGGCG
GGCCTCCAGCTTTACGCTGCCATTTCATCTGGCTCCTTATCGCTGTTCGCCACCATGGCCGACGCCATCTTCGAT
CCGCTCAGCGCCTTGACTCTCATTCTGTCGAGTCGGGCTATCGAGCGTGTCGACCCGAGACGCTTTCCGGCTGGC
AAGGCGCGTCTTGAAACGGTTGGGAACATCGTCTTTTGCTTTCTCATGATATCCGTCTCGCTCGTCATCATTGCT
CTCGCAGCGCAGCAACTCATCCAGAAGAGATCCGACGAGGAATTCCACTTGGCGTCCATCATCTCCGTCTGCGCC
GCTTTTGCCACGAAGCTTGCGCTCTTCCTGTTCTGCTGGACCATCAAGGACCGCTACAGCCAGGTCAAGATCCTA
TGGCAGGACCACCGCAACGACTTGTTCGTCAACGCCTTCGGCATCCTGACTGCCGTGGGCGGCGCACGGCTGGAG
TGGTGGATCGACCCAGCTGGTGCCATCACGCTGTCCATCATCATCTCAGCTGTCTGGCTTCGCACCTCGTTCGCC
GAGTTTCTCTTGCTGGTGGGCGTGGTGCCATCAGTCGAGACGCAGCAGCTGCTCACTTACGTATCTCTGACGCAC
TCGCCCATGATCCGAGAGATCGACACGATGCGGGCCTATTACTCGGGCCCGCGGCTTATCGTCGAAGTCGACGTC
GTCATGGACTCGACCGTAACCCTGGCCGAGTCACACGACGTGGCTGAGGACCTGCAGTGCAAGCTGGAGAGTCTT
CCCGAGGTGGAGCGGGCGTACGTTCACATTGACTATGAGACGACGCACAAGCCTGAGCACGCGTGTCTGAAGGAG
ATGTGA
Gene >Ophun1|3880
ATGTCATCGTCCAGTCACGGCACGTCGCCAGTCCGTCTCAAGGCCATGACGACAACACCGCTGGAGCGCATCGCC
TCGCAGACAACCGACGTCGAAAGCCAGACGACAACCAGCCGTCAAACACCCACGCCCGTCCTCAACGATCCCTAC
AACCTGACATCCCGCTTCAAGTCGGCCTCGGACCTGAACCGCATCGACAACAGATCCGCTCGCACGAGACTCGGC
AGCCTCATCCGACGCCTTCGTCCGCATACCGATGATGAGACCATCGGCCCTCGGCGCAGTGCCCGAAAGGTGCGC
GGCTTCTACGAGAAGCAGAACGCTGCCATCGAGCGGATGCTCAAGCCCGTAGAAGAGCACCGCGCAGACGCCCGT
CGAGAACAGGGCGACAACCAGCTCAAGTATCGCATAGCCGTCTACGGCTCTCTGGCCGCCAATGTCGTTCTGGCG
GGCCTCCAGCTTTACGCTGCCATTTCATCTGGCTCCTTATCGCTGTTCGCCACCATGGCCGACGCCATCTTCGAT
CCGCTCAGCGCCTTGACTCTCATTCTGTCGAGTCGGGCTATCGAGCGTGTCGACCCGAGACGCTTTCCGGCTGGC
AAGGCGCGTCTTGAAACGGTTGGGAACATCGTCTTTTGCTTTCTCATGATATCCGTCTCGCTCGTCATCATTGCT
CTCGCAGCGCAGCAACTCATCCAGAAGAGATCCGACGAGGAATTCCACTTGGCGTCCATCATCTCCGTCTGCGCC
GCTTTTGCCACGAAGCTTGCGCTCTTCCTGTTCTGCTGGACCATCAAGGACCGCTACAGCCAGGTCAAGATCCTA
TGGCAGGACCACCGCAACGACTTGTTCGTCAACGCCTTCGGCATCCTGACTGCCGTGGGCGGCGCACGGCTGGAG
TGGTGGATCGACCCAGCTGGTGCCATCACGCTGTCCATCATCATCTCAGCTGTCTGGCTTCGCACCTCGTTCGCC
GAGTTTCTCTTGCTGGTGGGCGTGGTGCCATCAGTCGAGACGCAGCAGCTGCTCACTTACGTATCTCTGACGCAC
TCGCCCATGATCCGAGAGATCGACACGATGCGGGCCTATTACTCGGGCCCGCGGCTTATCGTCGAAGTCGACGTC
GTCATGGACTCGACCGTAACCCTGGCCGAGTCACACGACGTGGCTGAGGACCTGCAGTGCAAGCTGGAGAGTCTT
CCCGAGGTGGAGCGGGCGTACGTTCACATTGACTATGAGACGACGCACAAGCCTGAGCACGCGTGTCTGAAGGAG
ATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail