Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3879
Gene name
LocationContig_35:36343..37472
Strand+
Gene length (bp)1129
Transcript length (bp)966
Coding sequence length (bp)966
Protein length (aa) 322

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12146 Hydrolase_4 Serine aminopeptidase, S33 1.3E-50 46 295
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 2.7E-14 50 303
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 3.6E-09 50 163

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94305|MGLL_SCHPO Putative monoglyceride lipase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC5E4.05c PE=1 SV=1 35 313 2.0E-34
sp|Q55EQ3|Y9086_DICDI Uncharacterized abhydrolase domain-containing protein DDB_G0269086 OS=Dictyostelium discoideum GN=DDB_G0269086 PE=1 SV=2 38 312 3.0E-31
sp|Q8R431|MGLL_RAT Monoglyceride lipase OS=Rattus norvegicus GN=Mgll PE=1 SV=1 35 312 1.0E-21
sp|O35678|MGLL_MOUSE Monoglyceride lipase OS=Mus musculus GN=Mgll PE=1 SV=1 35 312 2.0E-20
sp|Q99685|MGLL_HUMAN Monoglyceride lipase OS=Homo sapiens GN=MGLL PE=1 SV=2 35 313 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94305|MGLL_SCHPO Putative monoglyceride lipase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC5E4.05c PE=1 SV=1 35 313 2.0E-34
sp|Q55EQ3|Y9086_DICDI Uncharacterized abhydrolase domain-containing protein DDB_G0269086 OS=Dictyostelium discoideum GN=DDB_G0269086 PE=1 SV=2 38 312 3.0E-31
sp|Q8R431|MGLL_RAT Monoglyceride lipase OS=Rattus norvegicus GN=Mgll PE=1 SV=1 35 312 1.0E-21
sp|O35678|MGLL_MOUSE Monoglyceride lipase OS=Mus musculus GN=Mgll PE=1 SV=1 35 312 2.0E-20
sp|Q99685|MGLL_HUMAN Monoglyceride lipase OS=Homo sapiens GN=MGLL PE=1 SV=2 35 313 2.0E-20
sp|P28321|MGLL_YEAST Monoglyceride lipase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJU3 PE=1 SV=2 18 318 1.0E-16
sp|Q9C942|CSE_ARATH Caffeoylshikimate esterase OS=Arabidopsis thaliana GN=CSE PE=1 SV=1 25 318 2.0E-09
sp|O34705|PLBAC_BACSU Phospholipase YtpA OS=Bacillus subtilis (strain 168) GN=ytpA PE=1 SV=1 48 300 1.0E-07
sp|O64252|PRXH_BPMD2 Putative non-heme haloperoxidase OS=Mycobacterium phage D29 GN=59.2 PE=3 SV=1 48 143 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3879
MGCRTDRSEEPGMLDIQRAEEDIDESTFEHGDSSFYSKSWTPQGAIKAKLVFVHGFSEHINRYNDFFPKLVKHGI
QVLSWDQRGWGRSASKTWQKGRTGPTAEVIADVAAFVREKLVESDEASRVPVFVMGHSMGGGEVLTLAGDDNYAD
LVGRVRGWILESPFVGFPPGGEPSSVTVFAGRLMGRLLPKQQMKHAVAAELLTRDLDIVQSVRDDPLCHDTGTLE
GLASMLDRAENLSSGRVRLGKHVRSVLLTHGTKDMVCCCDAAVKFVDGQDAVEDKSWKLYDGAYHQLHTDHCKDD
FARDVAEWILKRSDEQVEAKL*
Coding >Ophun1|3879
ATGGGATGTCGGACCGATCGGTCCGAGGAGCCTGGCATGTTGGACATTCAACGAGCAGAAGAAGACATCGACGAG
TCGACGTTTGAGCACGGGGATTCCAGCTTCTATTCCAAGTCGTGGACGCCACAGGGCGCCATCAAGGCCAAGCTG
GTCTTCGTGCACGGCTTCAGCGAGCACATCAACCGCTACAACGACTTCTTCCCTAAGCTGGTCAAGCACGGCATC
CAAGTACTGTCCTGGGATCAGCGCGGATGGGGCCGCAGCGCCAGCAAGACGTGGCAGAAGGGCCGGACGGGACCG
ACAGCCGAGGTGATTGCCGACGTGGCAGCCTTTGTGCGCGAAAAGCTGGTGGAATCGGACGAGGCGTCGCGGGTG
CCCGTTTTCGTCATGGGCCACTCCATGGGCGGAGGCGAGGTCCTGACGCTGGCGGGCGACGACAACTACGCTGAC
CTGGTGGGACGCGTGCGAGGCTGGATCCTCGAGAGCCCCTTTGTTGGCTTCCCTCCCGGCGGAGAGCCCAGCAGC
GTGACCGTCTTCGCTGGCCGGCTCATGGGCCGACTTCTGCCCAAGCAGCAGATGAAGCACGCCGTGGCCGCCGAG
CTGCTAACGCGAGACCTGGACATTGTGCAGTCCGTGCGCGACGACCCTCTATGCCACGACACGGGCACGCTCGAA
GGACTGGCCTCGATGCTGGACCGGGCAGAGAACCTCTCGTCCGGCCGAGTCCGACTGGGGAAGCACGTGCGCAGC
GTGCTGCTTACGCACGGAACGAAGGATATGGTCTGCTGCTGCGATGCGGCTGTCAAGTTCGTCGACGGGCAGGAT
GCTGTTGAGGATAAGTCGTGGAAGCTGTATGATGGCGCGTACCATCAGCTTCATACTGATCATTGCAAAGATGAT
TTTGCGAGGGATGTGGCCGAGTGGATTTTGAAGCGGAGTGATGAGCAGGTTGAGGCCAAGTTGTGA
Transcript >Ophun1|3879
ATGGGATGTCGGACCGATCGGTCCGAGGAGCCTGGCATGTTGGACATTCAACGAGCAGAAGAAGACATCGACGAG
TCGACGTTTGAGCACGGGGATTCCAGCTTCTATTCCAAGTCGTGGACGCCACAGGGCGCCATCAAGGCCAAGCTG
GTCTTCGTGCACGGCTTCAGCGAGCACATCAACCGCTACAACGACTTCTTCCCTAAGCTGGTCAAGCACGGCATC
CAAGTACTGTCCTGGGATCAGCGCGGATGGGGCCGCAGCGCCAGCAAGACGTGGCAGAAGGGCCGGACGGGACCG
ACAGCCGAGGTGATTGCCGACGTGGCAGCCTTTGTGCGCGAAAAGCTGGTGGAATCGGACGAGGCGTCGCGGGTG
CCCGTTTTCGTCATGGGCCACTCCATGGGCGGAGGCGAGGTCCTGACGCTGGCGGGCGACGACAACTACGCTGAC
CTGGTGGGACGCGTGCGAGGCTGGATCCTCGAGAGCCCCTTTGTTGGCTTCCCTCCCGGCGGAGAGCCCAGCAGC
GTGACCGTCTTCGCTGGCCGGCTCATGGGCCGACTTCTGCCCAAGCAGCAGATGAAGCACGCCGTGGCCGCCGAG
CTGCTAACGCGAGACCTGGACATTGTGCAGTCCGTGCGCGACGACCCTCTATGCCACGACACGGGCACGCTCGAA
GGACTGGCCTCGATGCTGGACCGGGCAGAGAACCTCTCGTCCGGCCGAGTCCGACTGGGGAAGCACGTGCGCAGC
GTGCTGCTTACGCACGGAACGAAGGATATGGTCTGCTGCTGCGATGCGGCTGTCAAGTTCGTCGACGGGCAGGAT
GCTGTTGAGGATAAGTCGTGGAAGCTGTATGATGGCGCGTACCATCAGCTTCATACTGATCATTGCAAAGATGAT
TTTGCGAGGGATGTGGCCGAGTGGATTTTGAAGCGGAGTGATGAGCAGGTTGAGGCCAAGTTGTGA
Gene >Ophun1|3879
ATGGGATGTCGGACCGATCGGTCCGAGGAGCCTGGCATGTTGGGTAGGATTAATGCATTGGGGAAGCATAAACGA
CGCTGACGTTGACCAGTCAAGACATTCAACGAGCAGAAGAAGAGTCTGTCTTGTTCAGCACGCAACCATCATCGA
GACGCAGCGGCTCAACATGGCAAGCATCGACGAGTCGACGTTTGAGCACGGGGATTCCAGCTTCTATTCCAAGTC
GTGGACGGTGAGTCGAAGCGAGGACATGGACAGCTGTGGACGACGCTGACGCCCAATCCAGCCACAGGGCGCCAT
CAAGGCCAAGCTGGTCTTCGTGCACGGCTTCAGCGAGCACATCAACCGCTACAACGACTTCTTCCCTAAGCTGGT
CAAGCACGGCATCCAAGTACTGTCCTGGGATCAGCGCGGATGGGGCCGCAGCGCCAGCAAGACGTGGCAGAAGGG
CCGGACGGGACCGACAGCCGAGGTGATTGCCGACGTGGCAGCCTTTGTGCGCGAAAAGCTGGTGGAATCGGACGA
GGCGTCGCGGGTGCCCGTTTTCGTCATGGGCCACTCCATGGGCGGAGGCGAGGTCCTGACGCTGGCGGGCGACGA
CAACTACGCTGACCTGGTGGGACGCGTGCGAGGCTGGATCCTCGAGAGCCCCTTTGTTGGCTTCCCTCCCGGCGG
AGAGCCCAGCAGCGTGACCGTCTTCGCTGGCCGGCTCATGGGCCGACTTCTGCCCAAGCAGCAGATGAAGCACGC
CGTGGCCGCCGAGCTGCTAACGCGAGACCTGGACATTGTGCAGTCCGTGCGCGACGACCCTCTATGCCACGACAC
GGGCACGCTCGAAGGACTGGCCTCGATGCTGGACCGGGCAGAGAACCTCTCGTCCGGCCGAGTCCGACTGGGGAA
GCACGTGCGCAGCGTGCTGCTTACGCACGGAACGAAGGATATGGTCTGCTGCTGCGATGCGGCTGTCAAGTTCGT
CGACGGGCAGGATGCTGTTGAGGATAAGTCGTGGAAGCTGTATGATGGCGCGTACCATCAGCTTCATACTGATCA
TTGCAAAGATGATTTTGCGAGGGATGTGGCCGAGTGGATTTTGAAGCGGAGTGATGAGCAGGTTGAGGCCAAGTT
GTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail