Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3872
Gene name
LocationContig_35:20015..22691
Strand-
Gene length (bp)2676
Transcript length (bp)2493
Coding sequence length (bp)2493
Protein length (aa) 831

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01602 Adaptin_N Adaptin N terminal region 2.5E-144 20 582
PF02883 Alpha_adaptinC2 Adaptin C-terminal domain 5.3E-20 724 828

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43747|AP1G1_HUMAN AP-1 complex subunit gamma-1 OS=Homo sapiens GN=AP1G1 PE=1 SV=5 1 821 0.0E+00
sp|Q99128|AP1G1_USTMA AP-1 complex subunit gamma-1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=APL4 PE=3 SV=3 3 662 0.0E+00
sp|O75843|AP1G2_HUMAN AP-1 complex subunit gamma-like 2 OS=Homo sapiens GN=AP1G2 PE=1 SV=1 1 604 0.0E+00
sp|O88512|AP1G2_MOUSE AP-1 complex subunit gamma-like 2 OS=Mus musculus GN=Ap1g2 PE=1 SV=2 4 824 0.0E+00
sp|Q84K16|AP1G1_ARATH AP-1 complex subunit gamma-1 OS=Arabidopsis thaliana GN=GAMMA-ADR PE=1 SV=1 4 812 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43747|AP1G1_HUMAN AP-1 complex subunit gamma-1 OS=Homo sapiens GN=AP1G1 PE=1 SV=5 1 821 0.0E+00
sp|Q99128|AP1G1_USTMA AP-1 complex subunit gamma-1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=APL4 PE=3 SV=3 3 662 0.0E+00
sp|O75843|AP1G2_HUMAN AP-1 complex subunit gamma-like 2 OS=Homo sapiens GN=AP1G2 PE=1 SV=1 1 604 0.0E+00
sp|O88512|AP1G2_MOUSE AP-1 complex subunit gamma-like 2 OS=Mus musculus GN=Ap1g2 PE=1 SV=2 4 824 0.0E+00
sp|Q84K16|AP1G1_ARATH AP-1 complex subunit gamma-1 OS=Arabidopsis thaliana GN=GAMMA-ADR PE=1 SV=1 4 812 0.0E+00
sp|Q9ZUI6|AP1G2_ARATH AP-1 complex subunit gamma-2 OS=Arabidopsis thaliana GN=At1g60070 PE=1 SV=2 4 812 0.0E+00
sp|Q8I8U2|AP1G_DICDI AP-1 complex subunit gamma OS=Dictyostelium discoideum GN=ap1g1 PE=1 SV=1 4 607 0.0E+00
sp|Q5R5M2|AP1G1_PONAB AP-1 complex subunit gamma-1 OS=Pongo abelii GN=AP1G1 PE=2 SV=1 1 821 0.0E+00
sp|P22892|AP1G1_MOUSE AP-1 complex subunit gamma-1 OS=Mus musculus GN=Ap1g1 PE=1 SV=3 1 821 0.0E+00
sp|Q9UU81|AP1G1_SCHPO AP-1 complex subunit gamma-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl4 PE=3 SV=1 1 826 0.0E+00
sp|Q12028|AP1G1_YEAST AP-1 complex subunit gamma-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APL4 PE=1 SV=1 3 812 2.0E-128
sp|Q8LPL6|AP2A1_ARATH AP-2 complex subunit alpha-1 OS=Arabidopsis thaliana GN=ALPHA-ADR PE=1 SV=1 7 595 2.0E-84
sp|Q8LPK4|AP2A2_ARATH AP-2 complex subunit alpha-2 OS=Arabidopsis thaliana GN=ALPHAC-AD PE=1 SV=1 7 595 3.0E-84
sp|P17427|AP2A2_MOUSE AP-2 complex subunit alpha-2 OS=Mus musculus GN=Ap2a2 PE=1 SV=2 7 663 5.0E-81
sp|P18484|AP2A2_RAT AP-2 complex subunit alpha-2 OS=Rattus norvegicus GN=Ap2a2 PE=1 SV=3 7 663 7.0E-81
sp|O94973|AP2A2_HUMAN AP-2 complex subunit alpha-2 OS=Homo sapiens GN=AP2A2 PE=1 SV=2 7 657 1.0E-77
sp|Q0VCK5|AP2A2_BOVIN AP-2 complex subunit alpha-2 OS=Bos taurus GN=AP2A2 PE=1 SV=1 7 660 3.0E-76
sp|Q86KI1|AP2A2_DICDI AP-2 complex subunit alpha-2 OS=Dictyostelium discoideum GN=ap2a1-1 PE=3 SV=1 1 595 6.0E-76
sp|O95782|AP2A1_HUMAN AP-2 complex subunit alpha-1 OS=Homo sapiens GN=AP2A1 PE=1 SV=3 7 687 2.0E-75
sp|P17426|AP2A1_MOUSE AP-2 complex subunit alpha-1 OS=Mus musculus GN=Ap2a1 PE=1 SV=1 7 687 3.0E-75
sp|Q29N38|AP2A_DROPS AP-2 complex subunit alpha OS=Drosophila pseudoobscura pseudoobscura GN=alpha-Adaptin PE=3 SV=1 7 666 5.0E-73
sp|Q7QG73|AP2A_ANOGA AP-2 complex subunit alpha OS=Anopheles gambiae GN=alpha-Adaptin PE=3 SV=4 1 613 2.0E-71
sp|P91926|AP2A_DROME AP-2 complex subunit alpha OS=Drosophila melanogaster GN=AP-2alpha PE=1 SV=1 7 764 9.0E-71
sp|Q9C0W7|AP2A_SCHPO AP-2 complex subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl3 PE=3 SV=1 1 596 2.0E-61
sp|Q8L7A9|AP4E_ARATH AP-4 complex subunit epsilon OS=Arabidopsis thaliana GN=At1g31730 PE=1 SV=1 7 584 3.0E-60
sp|Q80V94|AP4E1_MOUSE AP-4 complex subunit epsilon-1 OS=Mus musculus GN=Ap4e1 PE=1 SV=3 7 592 5.0E-60
sp|Q9UPM8|AP4E1_HUMAN AP-4 complex subunit epsilon-1 OS=Homo sapiens GN=AP4E1 PE=1 SV=2 7 591 3.0E-59
sp|P54362|AP3D_DROME AP-3 complex subunit delta OS=Drosophila melanogaster GN=g PE=1 SV=4 3 574 1.0E-40
sp|O54774|AP3D1_MOUSE AP-3 complex subunit delta-1 OS=Mus musculus GN=Ap3d1 PE=1 SV=1 3 574 1.0E-39
sp|Q54VE0|AP4E_DICDI AP-4 complex subunit epsilon OS=Dictyostelium discoideum GN=ap4e1 PE=3 SV=1 7 576 2.0E-39
sp|O14617|AP3D1_HUMAN AP-3 complex subunit delta-1 OS=Homo sapiens GN=AP3D1 PE=1 SV=1 3 574 3.0E-39
sp|Q865S1|AP3D1_BOVIN AP-3 complex subunit delta-1 OS=Bos taurus GN=AP3D1 PE=1 SV=2 3 574 2.0E-38
sp|Q54WN0|AP3D_DICDI AP-3 complex subunit delta OS=Dictyostelium discoideum GN=ap3d1 PE=3 SV=1 49 497 6.0E-34
sp|Q9UTL8|AP3D_SCHPO AP-3 complex subunit delta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl5 PE=3 SV=2 7 659 3.0E-32
sp|P38065|AP2A_YEAST AP-2 complex subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APL3 PE=1 SV=1 7 610 4.0E-26
sp|Q755A1|AP3D_ASHGO AP-3 complex subunit delta OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=APL5 PE=3 SV=1 3 576 1.0E-25
sp|Q9C744|AP3D_ARATH AP-3 complex subunit delta OS=Arabidopsis thaliana GN=DELTA-ADR PE=1 SV=1 28 574 3.0E-25
sp|Q08951|AP3D_YEAST AP-3 complex subunit delta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APL5 PE=1 SV=1 3 576 1.0E-24
sp|Q54X82|AP1B_DICDI AP-1 complex subunit beta OS=Dictyostelium discoideum GN=ap1b1 PE=3 SV=1 45 493 1.0E-11
sp|Q9SV21|COPB1_ARATH Coatomer subunit beta-1 OS=Arabidopsis thaliana GN=At4g31480 PE=2 SV=2 99 492 2.0E-11
sp|Q9SV20|COPB2_ARATH Coatomer subunit beta-2 OS=Arabidopsis thaliana GN=At4g31490 PE=2 SV=2 99 492 7.0E-11
sp|Q23924|COPB_DICDI Coatomer subunit beta OS=Dictyostelium discoideum GN=copb PE=2 SV=2 39 515 1.0E-10
sp|Q54HL0|COPG_DICDI Coatomer subunit gamma OS=Dictyostelium discoideum GN=copG PE=1 SV=1 49 597 8.0E-10
sp|P62944|AP2B1_RAT AP-2 complex subunit beta OS=Rattus norvegicus GN=Ap2b1 PE=1 SV=1 45 748 7.0E-09
sp|P63010|AP2B1_HUMAN AP-2 complex subunit beta OS=Homo sapiens GN=AP2B1 PE=1 SV=1 45 748 7.0E-09
sp|O81742|APBLC_ARATH Beta-adaptin-like protein C OS=Arabidopsis thaliana GN=BETAC-AD PE=1 SV=2 45 493 8.0E-09
sp|Q9DBG3|AP2B1_MOUSE AP-2 complex subunit beta OS=Mus musculus GN=Ap2b1 PE=1 SV=1 45 748 9.0E-09
sp|P41810|COPB_YEAST Coatomer subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC26 PE=1 SV=2 99 493 3.0E-08
sp|Q9SUS3|APBLB_ARATH Beta-adaptin-like protein B OS=Arabidopsis thaliana GN=BETAB-AD PE=1 SV=1 45 493 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0030117 membrane coat Yes
GO:0016192 vesicle-mediated transport Yes
GO:0051179 localization No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0008104 protein localization No
GO:0046907 intracellular transport No
GO:0051234 establishment of localization No
GO:0098796 membrane protein complex No
GO:0032991 protein-containing complex No
GO:0051649 establishment of localization in cell No
GO:0071705 nitrogen compound transport No
GO:0033036 macromolecule localization No
GO:0070727 cellular macromolecule localization No
GO:0005575 cellular_component No
GO:0015031 protein transport No
GO:0045184 establishment of protein localization No
GO:0008150 biological_process No
GO:0051641 cellular localization No
GO:0071702 organic substance transport No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5254
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|624
Ophiocordyceps australis map64 (Brazil) OphauB2|4880
Ophiocordyceps camponoti-floridani Ophcf2|06087
Ophiocordyceps camponoti-rufipedis Ophun1|3872 (this protein)
Ophiocordyceps kimflemingae Ophio5|213
Ophiocordyceps subramaniannii Hirsu2|4473

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3872
MPSVKQFIRNVRAAKTIADERAVIQKESAAIRASFREESADHGVRRNNVAKLLYLFTLGERTHFGQIECLKLLAS
PRFADKRLGHLATSLLLDENQEVLTLVTNSLKNDLSHSNQYIVGLALCTLGNIASIEMSRDLFPEIEQLISTSNP
YIRRKAALCAMRICRKVPDLQEHFLEKAAHLLADRNHGVLLCGLTLVTSLCEADEEEEGGENEEVIIEKFRTFVP
SLVKTLKGLSTSGYAPEHDVTGITDPFLQVKILRLLRVLAVGDAETSEQINDILAQVATNTDSSKNVGNSILYEA
VRTILDIEADSGLRVLGVNILGKFLTNRDNNIRYVALNTLIKVVAIEPNAVQRHRNTILECLRDPDISIRRRALE
LSFTLINESNVRVLIRELLAFLEVADNEFKPTMTSQIGIAADKFAPSKRWHFDTMLRVLSLAGNYLKEQILSSFI
RLLATTPELQPYAVQKLYANLKLDITQESLTQAAAWCVGEYADVLLRGGQYEDEVIRPVKESEVVDLLALILGSS
YATQVTTEYIVTALMKLTTRFSEASQVERIRRILQTHQTSLDVEVQQRAVEYGNLFSFDEVRRGVLEKMPPPQIK
EESRVLGAAPTKKNKGANRKSRVIKPTEQDLLDLMDAPPASAPGNGSQASNSDLLADILGGGSNAAPSQVSSTPS
QTTTPSIMDLFGSEPGQPPSQSMAGSSSSAGLDLMGSAAPAQTPQPGHACYDANGLKVTMQLQRNAEGVIQATAR
FQNGAGSAALSNVGLQAAVPKSQKLQLLSISSSELGAGALATQMMRISGCKGLLRLRLRIGYTHPSKGQVMDQVN
WTEPS*
Coding >Ophun1|3872
ATGCCTTCAGTGAAGCAGTTTATTCGAAATGTTCGCGCAGCCAAGACGATAGCAGATGAGCGAGCGGTGATACAG
AAGGAGAGCGCAGCCATACGCGCCAGCTTTCGTGAGGAGAGCGCCGACCATGGCGTCCGACGCAACAATGTCGCG
AAGCTGCTGTATCTCTTCACCCTCGGCGAGCGCACGCATTTTGGACAGATTGAATGCCTCAAGCTTCTGGCGTCT
CCTCGCTTCGCCGACAAGCGTCTGGGCCATCTCGCCACGAGCTTGCTCCTCGACGAGAACCAAGAAGTGCTGACG
CTGGTTACAAACTCGCTCAAGAATGATCTGAGCCACTCGAACCAGTACATCGTCGGGCTGGCCCTGTGCACGCTC
GGCAACATAGCCTCTATCGAGATGTCGCGCGACCTGTTCCCCGAGATCGAGCAACTTATATCAACCTCCAATCCC
TATATCCGACGGAAAGCAGCCCTCTGTGCAATGCGGATATGCCGCAAGGTCCCAGACCTGCAAGAACACTTCCTC
GAAAAAGCGGCTCATTTGCTGGCTGACAGAAACCACGGCGTTCTCCTCTGTGGTCTGACGCTAGTCACCAGCTTG
TGTGAAGCCGACGAGGAGGAAGAGGGAGGAGAGAACGAAGAAGTCATCATCGAAAAGTTTAGGACCTTTGTGCCG
AGTCTAGTCAAGACGCTCAAGGGTCTGTCGACATCGGGATACGCTCCGGAGCATGATGTAACGGGCATCACCGAC
CCGTTCTTGCAAGTCAAGATCCTCCGGCTGCTGCGCGTTCTCGCCGTGGGAGATGCCGAGACGAGCGAGCAGATC
AACGACATTCTGGCTCAAGTGGCAACTAACACCGACTCGTCCAAGAATGTAGGAAACTCGATACTGTACGAGGCG
GTCCGTACGATTCTCGACATCGAGGCAGACTCGGGTCTTCGGGTGCTGGGAGTCAACATCTTGGGCAAGTTTCTC
ACGAACCGAGACAACAACATCCGATACGTGGCCCTCAATACGCTCATCAAAGTCGTTGCCATTGAACCCAATGCC
GTCCAAAGACACCGCAATACCATCCTCGAGTGTTTGCGAGACCCAGACATCAGCATTCGGAGGAGGGCGCTCGAG
CTCAGTTTCACCCTTATCAACGAGAGCAATGTCCGGGTGCTTATTCGCGAGCTTCTGGCTTTCCTCGAGGTGGCG
GATAACGAATTCAAGCCAACGATGACGAGCCAGATCGGCATAGCCGCCGATAAGTTTGCCCCCAGCAAGCGATGG
CACTTTGACACGATGTTACGGGTCCTCTCACTAGCAGGCAACTACTTGAAAGAGCAGATCCTGTCGTCGTTCATC
CGCCTCCTCGCGACCACACCGGAGCTTCAGCCATACGCGGTTCAGAAGTTGTATGCCAATCTCAAACTGGACATT
ACGCAGGAAAGCCTGACGCAGGCGGCCGCGTGGTGTGTGGGCGAATACGCCGACGTGCTTCTCAGAGGCGGCCAG
TACGAAGACGAGGTCATCCGGCCCGTCAAGGAGAGCGAGGTGGTAGACCTTCTCGCACTGATACTGGGCAGCAGC
TACGCCACGCAGGTGACCACGGAATACATTGTCACAGCCCTTATGAAGCTCACGACTCGGTTCTCGGAGGCTTCT
CAGGTGGAGAGGATACGGCGAATCTTGCAAACCCACCAGACAAGTCTAGATGTCGAGGTGCAACAGCGGGCAGTC
GAGTACGGCAACCTCTTCTCGTTTGACGAGGTCCGCCGTGGCGTGTTGGAGAAGATGCCGCCTCCGCAGATCAAG
GAGGAGTCTCGAGTGCTGGGCGCGGCGCCGACCAAGAAGAACAAGGGAGCCAACAGGAAGTCCAGGGTTATCAAG
CCGACGGAGCAGGACTTATTGGACCTCATGGATGCTCCGCCGGCGAGCGCGCCTGGGAACGGCTCGCAGGCGTCC
AACTCGGATCTCCTAGCCGACATTTTGGGCGGCGGTAGTAACGCGGCTCCGTCGCAGGTCTCCTCGACGCCTTCT
CAGACGACAACGCCGTCCATAATGGACCTGTTCGGCTCCGAGCCCGGTCAGCCCCCGAGCCAGTCAATGGCAGGC
TCCTCGTCATCGGCCGGACTCGACCTCATGGGTTCAGCCGCTCCCGCACAGACGCCCCAGCCAGGCCACGCCTGC
TACGACGCAAACGGGCTGAAGGTGACAATGCAGCTCCAGCGCAACGCCGAGGGCGTCATCCAAGCCACTGCTCGC
TTCCAAAACGGCGCCGGGTCCGCGGCGCTCTCCAACGTCGGGCTGCAGGCAGCCGTGCCCAAGTCTCAGAAGCTA
CAGCTGCTGAGCATCTCGTCGTCGGAATTGGGGGCGGGCGCATTGGCAACGCAGATGATGCGGATATCCGGTTGC
AAAGGGCTGCTTCGGCTGCGGCTGAGGATCGGGTACACGCATCCCTCGAAGGGACAGGTCATGGACCAGGTCAAC
TGGACGGAGCCGTCGTAG
Transcript >Ophun1|3872
ATGCCTTCAGTGAAGCAGTTTATTCGAAATGTTCGCGCAGCCAAGACGATAGCAGATGAGCGAGCGGTGATACAG
AAGGAGAGCGCAGCCATACGCGCCAGCTTTCGTGAGGAGAGCGCCGACCATGGCGTCCGACGCAACAATGTCGCG
AAGCTGCTGTATCTCTTCACCCTCGGCGAGCGCACGCATTTTGGACAGATTGAATGCCTCAAGCTTCTGGCGTCT
CCTCGCTTCGCCGACAAGCGTCTGGGCCATCTCGCCACGAGCTTGCTCCTCGACGAGAACCAAGAAGTGCTGACG
CTGGTTACAAACTCGCTCAAGAATGATCTGAGCCACTCGAACCAGTACATCGTCGGGCTGGCCCTGTGCACGCTC
GGCAACATAGCCTCTATCGAGATGTCGCGCGACCTGTTCCCCGAGATCGAGCAACTTATATCAACCTCCAATCCC
TATATCCGACGGAAAGCAGCCCTCTGTGCAATGCGGATATGCCGCAAGGTCCCAGACCTGCAAGAACACTTCCTC
GAAAAAGCGGCTCATTTGCTGGCTGACAGAAACCACGGCGTTCTCCTCTGTGGTCTGACGCTAGTCACCAGCTTG
TGTGAAGCCGACGAGGAGGAAGAGGGAGGAGAGAACGAAGAAGTCATCATCGAAAAGTTTAGGACCTTTGTGCCG
AGTCTAGTCAAGACGCTCAAGGGTCTGTCGACATCGGGATACGCTCCGGAGCATGATGTAACGGGCATCACCGAC
CCGTTCTTGCAAGTCAAGATCCTCCGGCTGCTGCGCGTTCTCGCCGTGGGAGATGCCGAGACGAGCGAGCAGATC
AACGACATTCTGGCTCAAGTGGCAACTAACACCGACTCGTCCAAGAATGTAGGAAACTCGATACTGTACGAGGCG
GTCCGTACGATTCTCGACATCGAGGCAGACTCGGGTCTTCGGGTGCTGGGAGTCAACATCTTGGGCAAGTTTCTC
ACGAACCGAGACAACAACATCCGATACGTGGCCCTCAATACGCTCATCAAAGTCGTTGCCATTGAACCCAATGCC
GTCCAAAGACACCGCAATACCATCCTCGAGTGTTTGCGAGACCCAGACATCAGCATTCGGAGGAGGGCGCTCGAG
CTCAGTTTCACCCTTATCAACGAGAGCAATGTCCGGGTGCTTATTCGCGAGCTTCTGGCTTTCCTCGAGGTGGCG
GATAACGAATTCAAGCCAACGATGACGAGCCAGATCGGCATAGCCGCCGATAAGTTTGCCCCCAGCAAGCGATGG
CACTTTGACACGATGTTACGGGTCCTCTCACTAGCAGGCAACTACTTGAAAGAGCAGATCCTGTCGTCGTTCATC
CGCCTCCTCGCGACCACACCGGAGCTTCAGCCATACGCGGTTCAGAAGTTGTATGCCAATCTCAAACTGGACATT
ACGCAGGAAAGCCTGACGCAGGCGGCCGCGTGGTGTGTGGGCGAATACGCCGACGTGCTTCTCAGAGGCGGCCAG
TACGAAGACGAGGTCATCCGGCCCGTCAAGGAGAGCGAGGTGGTAGACCTTCTCGCACTGATACTGGGCAGCAGC
TACGCCACGCAGGTGACCACGGAATACATTGTCACAGCCCTTATGAAGCTCACGACTCGGTTCTCGGAGGCTTCT
CAGGTGGAGAGGATACGGCGAATCTTGCAAACCCACCAGACAAGTCTAGATGTCGAGGTGCAACAGCGGGCAGTC
GAGTACGGCAACCTCTTCTCGTTTGACGAGGTCCGCCGTGGCGTGTTGGAGAAGATGCCGCCTCCGCAGATCAAG
GAGGAGTCTCGAGTGCTGGGCGCGGCGCCGACCAAGAAGAACAAGGGAGCCAACAGGAAGTCCAGGGTTATCAAG
CCGACGGAGCAGGACTTATTGGACCTCATGGATGCTCCGCCGGCGAGCGCGCCTGGGAACGGCTCGCAGGCGTCC
AACTCGGATCTCCTAGCCGACATTTTGGGCGGCGGTAGTAACGCGGCTCCGTCGCAGGTCTCCTCGACGCCTTCT
CAGACGACAACGCCGTCCATAATGGACCTGTTCGGCTCCGAGCCCGGTCAGCCCCCGAGCCAGTCAATGGCAGGC
TCCTCGTCATCGGCCGGACTCGACCTCATGGGTTCAGCCGCTCCCGCACAGACGCCCCAGCCAGGCCACGCCTGC
TACGACGCAAACGGGCTGAAGGTGACAATGCAGCTCCAGCGCAACGCCGAGGGCGTCATCCAAGCCACTGCTCGC
TTCCAAAACGGCGCCGGGTCCGCGGCGCTCTCCAACGTCGGGCTGCAGGCAGCCGTGCCCAAGTCTCAGAAGCTA
CAGCTGCTGAGCATCTCGTCGTCGGAATTGGGGGCGGGCGCATTGGCAACGCAGATGATGCGGATATCCGGTTGC
AAAGGGCTGCTTCGGCTGCGGCTGAGGATCGGGTACACGCATCCCTCGAAGGGACAGGTCATGGACCAGGTCAAC
TGGACGGAGCCGTCGTAG
Gene >Ophun1|3872
ATGCCTTCAGTGAAGCAGTTTATTCGAAATGTTCGCGCAGCCAAGACGATAGCAGATGAGCGAGCGGTGATACAG
AAGGAGAGCGCAGCCATACGCGCCAGCTTTCGTGAGGAGAGCGCCGACCATGGCGTCCGGTGAGTGCGCAACGGC
GGTGTAGGGAGTCTGCAGCGAAGATTCGCTTACTTCTTGCTCAGACGCAACAATGTCGCGAAGCTGCTGTATCTC
TTCACCCTCGGCGAGCGCACGCATTTTGGACAGATTGAATGCCTCAAGCTTCTGGCGTCTCCTCGCTTCGCCGAC
AAGCGTCTGGGCCATCTCGCCACGAGCTTGCTCCTCGACGAGAACCAAGAAGTGCTGACGCTGGTTACAAACTCG
CTCAAGAAGTGAGCAACCCTGAAACCCACGCGCGAATTTCTGTCTGAGGCTTACACGCAACAACAGTGATCTGAG
CCACTCGAACCAGTACATCGTCGGGCTGGCCCTGTGCACGCTCGGCAACATAGCCTCTATCGAGATGTCGCGCGA
CCTGTTCCCCGAGATCGAGCAACTTATATCAACCTCCAATCCCTATATCCGACGGAAAGCAGCCCTCTGTGCAAT
GCGGATATGCCGCAAGGTCCCAGACCTGCAAGAACACTTCCTCGAAAAAGCGGCTCATTTGCTGGCTGACAGAAA
CCACGGCGTTCTCCTCTGTGGTCTGACGCTAGTCACCAGCTTGTGTGAAGCCGACGAGGAGGAAGAGGGAGGAGA
GAACGAAGAAGTCATCATCGAAAAGTTTAGGACCTTTGTGCCGAGTCTAGTCAAGACGCTCAAGGGTCTGTCGAC
ATCGGGATACGCTCCGGAGCATGATGTAACGGGCATCACCGACCCGTTCTTGCAAGTCAAGATCCTCCGGCTGCT
GCGCGTTCTCGCCGTGGGAGATGCCGAGACGAGCGAGCAGATCAACGACATTCTGGCTCAAGTGGCAACTAACAC
CGACTCGTCCAAGAATGTAGGAAACTCGATACTGTACGAGGCGGTCCGTACGATTCTCGACATCGAGGCAGACTC
GGGTCTTCGGGTGCTGGGAGTCAACATCTTGGGCAAGTTTCTCACGAACCGAGACAACAACATCCGATACGTGGC
CCTCAATACGCTCATCAAAGTCGTTGCCATTGAACCCAATGCCGTCCAAAGACACCGCAATACCATCCTCGAGTG
TTTGCGAGACCCAGACATCAGCATTCGGAGGAGGGCGCTCGAGCTCAGTTTCACCCTTATCAACGAGAGCAATGT
CCGGGTGCTTATTCGCGAGCTTCTGGCTTTCCTCGAGGTGGCGGATAACGAATTCAAGCCAACGATGACGAGCCA
GATCGGCATAGCCGCCGATAAGTTTGCCCCCAGCAAGCGATGGCACTTTGACACGATGTTACGGGTCCTCTCACT
AGCAGGCAACTACTTGAAAGAGCAGATCCTGTCGTCGTTCATCCGCCTCCTCGCGACCACACCGGAGCTTCAGCC
ATACGCGGTTCAGAAGTTGTATGCCAATCTCAAACTGGACATTACGCAGGAAAGCCTGACGCAGGCGGCCGCGTG
GTGTGTGGGCGAATACGCCGACGTGCTTCTCAGAGGCGGCCAGTACGAAGACGAGGTCATCCGGCCCGTCAAGGA
GAGCGAGGTGGTAGACCTTCTCGCACTGATACTGGGCAGCAGCTACGCCACGCAGGTGACCACGGAATACATTGT
CACAGCCCTTATGAAGCTCACGACTCGGTTCTCGGAGGCTTCTCAGGTGGAGAGGATACGGCGAATCTTGCAAAC
CCACCAGACAAGTCTAGATGTCGAGGTGCAACAGCGGGCAGTCGAGTACGGCAACCTCTTCTCGTTTGACGAGGT
CCGCCGTGGCGTGTTGGAGAAGATGCCGCCTCCGCAGATCAAGGAGGAGTCTCGAGTGCTGGGCGCGGCGCCGAC
CAAGAAGAACAAGGGAGCCAACAGGAAGTCCAGGGTTATCAAGCCGACGGAGCAGGACTTATTGGACCTCATGGA
TGCTCCGCCGGCGAGCGCGCCTGGGAACGGCTCGCAGGCGTCCAACTCGGATCTCCTAGCCGACATTTTGGGCGG
CGGTAGTAACGCGGCTCCGTCGCAGGTCTCCTCGACGCCTTCTCAGACGACAACGCCGTCCATAATGGACCTGTT
CGGCTCCGAGCCCGGTCAGCCCCCGAGCCAGTCAATGGCAGGCTCCTCGTCATCGGCCGGACTCGACCTCATGGG
TTCAGCCGCTCCCGCACAGACGCCCCAGCCAGGCCACGCCTGCTACGACGCAAACGGGCTGAAGGTGACAATGCA
GCTCCAGCGCAACGCCGAGGGCGTCATCCAAGCCACTGCTCGCTTCCAAAACGGCGCCGGGTCCGCGGCGCTCTC
CAACGTCGGGCTGCAGGCAGCCGTGCCCAAGTCTCAGAAGCTACAGCTGCTGAGCATCTCGTCGTCGGAATTGGG
GGCGGGCGCATTGGCAACGCAGATGATGCGGATATCCGGTTGCAAAGGGGTGAGTCTTGATTTTCCTTTTGTTGT
CTCCCGGGGCTCTCCTTGGCTGACGAGCGGATTGCGCAGCTGCTTCGGCTGCGGCTGAGGATCGGGTACACGCAT
CCCTCGAAGGGACAGGTCATGGACCAGGTCAACTGGACGGAGCCGTCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail