Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3862
Gene name
LocationContig_349:2352..3722
Strand-
Gene length (bp)1370
Transcript length (bp)1155
Coding sequence length (bp)1155
Protein length (aa) 385

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03345 DDOST_48kD Oligosaccharyltransferase 48 kDa subunit beta 8.9E-131 2 370

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59866|OSTB_SCHPO Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit wbp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wbp1 PE=2 SV=2 1 374 1.0E-54
sp|P45971|OST48_CAEEL Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Caenorhabditis elegans GN=ostb-1 PE=3 SV=1 4 374 3.0E-49
sp|Q944K2|OST48_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Arabidopsis thaliana GN=OST48 PE=2 SV=1 1 371 8.0E-46
sp|P48440|OST48_CHICK Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Gallus gallus GN=DDOST PE=1 SV=1 1 368 8.0E-45
sp|Q6ZLK0|OST48_ORYSJ Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Oryza sativa subsp. japonica GN=OST48 PE=2 SV=1 1 371 1.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59866|OSTB_SCHPO Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit wbp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wbp1 PE=2 SV=2 1 374 1.0E-54
sp|P45971|OST48_CAEEL Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Caenorhabditis elegans GN=ostb-1 PE=3 SV=1 4 374 3.0E-49
sp|Q944K2|OST48_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Arabidopsis thaliana GN=OST48 PE=2 SV=1 1 371 8.0E-46
sp|P48440|OST48_CHICK Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Gallus gallus GN=DDOST PE=1 SV=1 1 368 8.0E-45
sp|Q6ZLK0|OST48_ORYSJ Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Oryza sativa subsp. japonica GN=OST48 PE=2 SV=1 1 371 1.0E-44
sp|Q6NYS8|OST48_DANRE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Danio rerio GN=ddost PE=2 SV=2 1 371 2.0E-43
sp|Q6GNR9|OST48_XENLA Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Xenopus laevis GN=ddost PE=2 SV=1 1 368 1.0E-42
sp|B1H3C9|OST48_XENTR Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Xenopus tropicalis GN=ddost PE=2 SV=1 1 368 1.0E-42
sp|Q29381|OST48_PIG Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Sus scrofa GN=DDOST PE=1 SV=2 1 368 2.0E-42
sp|P39656|OST48_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Homo sapiens GN=DDOST PE=1 SV=4 1 368 4.0E-42
sp|Q5R501|OST48_PONAB Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Pongo abelii GN=DDOST PE=2 SV=2 1 368 6.0E-42
sp|Q05052|OST48_CANLF Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Canis lupus familiaris GN=DDOST PE=1 SV=1 1 368 1.0E-41
sp|A6QPY0|OST48_BOVIN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Bos taurus GN=DDOST PE=2 SV=2 1 368 1.0E-41
sp|Q641Y0|OST48_RAT Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Rattus norvegicus GN=Ddost PE=2 SV=1 1 368 3.0E-41
sp|O54734|OST48_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Mus musculus GN=Ddost PE=1 SV=2 1 368 6.0E-41
sp|Q24319|OST48_DROME Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Drosophila melanogaster GN=Ost48 PE=2 SV=2 1 368 2.0E-40
sp|P33767|OSTB_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=WBP1 PE=1 SV=1 18 373 1.0E-37
sp|Q54E62|OST48_DICDI Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Dictyostelium discoideum GN=ddost PE=3 SV=1 20 371 6.0E-33
[Show less]

GO

GO Term Description Terminal node
GO:0005789 endoplasmic reticulum membrane Yes
GO:0018279 protein N-linked glycosylation via asparagine Yes
GO:0043412 macromolecule modification No
GO:0043413 macromolecule glycosylation No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0006486 protein glycosylation No
GO:0070085 glycosylation No
GO:0018193 peptidyl-amino acid modification No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0016020 membrane No
GO:0006807 nitrogen compound metabolic process No
GO:0006487 protein N-linked glycosylation No
GO:0110165 cellular anatomical entity No
GO:0036211 protein modification process No
GO:0005575 cellular_component No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0018196 peptidyl-asparagine modification No
GO:0031090 organelle membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 347 369 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3862
MVQLAASTSRLGPNMTPKMLVEFVKAGGNMMVALSSTTPAPSSLVSMLAEFEVTLPVERTGLVVDHFNYDTLSAA
QKHDVLVLDAPSKAPVGVTDLFVMPGTVLAFPRTSGHLLGQSPLLTPLVRAPFTAYSYNPKEQAEGIDPDDFFGA
GQQLSLVTAIQARNSARIVVVGSAEMLQDQWIEAKVAHVDKTPVKAGNREFAKKLTGWAFQEIGVLRVNSIEHHL
KGSKEMNPGIYRIKNDVSFTISMSEYSWDKWVPFQVPKDDDLQMEFSMLSPFVRLNLRKKKTTKTAAIFGRDFQL
PDQHGIFNFLVNYKRELLTYVDEKRTVSVRHIAHDEWPRSYDISAAWPWLSGIWTTVVGWLMFLALWLFSRPVRQ
GGSRGQGRG*
Coding >Ophun1|3862
ATGGTGCAGCTCGCGGCTTCGACCTCGCGCCTTGGGCCCAACATGACGCCCAAGATGCTGGTCGAGTTTGTCAAG
GCTGGCGGCAACATGATGGTTGCTCTGTCTTCCACCACGCCCGCTCCCTCGTCTCTCGTCTCCATGTTGGCCGAG
TTCGAGGTGACGTTGCCGGTGGAGAGGACGGGGCTGGTGGTGGACCATTTCAACTACGATACTCTGTCGGCGGCG
CAGAAGCATGATGTGCTTGTCCTCGATGCACCCAGCAAGGCTCCTGTCGGCGTGACCGACTTGTTCGTCATGCCC
GGCACCGTCTTGGCCTTTCCGCGTACTTCTGGCCATCTACTCGGTCAGAGCCCGCTGTTGACGCCCCTGGTTCGC
GCCCCTTTTACTGCCTACAGTTACAATCCCAAGGAGCAGGCCGAGGGGATCGACCCGGATGACTTTTTCGGCGCT
GGCCAGCAGCTCAGTCTCGTGACGGCTATTCAGGCGCGCAACTCGGCTCGCATCGTCGTCGTCGGCTCGGCGGAG
ATGCTGCAGGATCAATGGATCGAGGCCAAAGTGGCGCACGTGGATAAGACGCCTGTCAAGGCGGGGAACCGCGAG
TTTGCAAAGAAGCTCACCGGCTGGGCGTTTCAGGAGATTGGCGTGTTGCGCGTCAACTCGATTGAGCATCATCTC
AAGGGATCCAAGGAGATGAATCCTGGCATTTACCGCATCAAGAACGACGTGTCGTTTACCATCTCCATGTCAGAG
TACTCGTGGGACAAGTGGGTGCCCTTCCAGGTTCCCAAGGACGACGATCTGCAGATGGAGTTTTCGATGCTCTCG
CCCTTTGTGCGTCTCAACCTTCGGAAGAAGAAGACGACCAAGACGGCAGCCATCTTCGGACGCGACTTTCAGCTA
CCGGATCAGCACGGCATCTTCAACTTCCTCGTCAACTACAAGCGGGAGCTCCTGACGTACGTGGACGAGAAGCGA
ACCGTCAGCGTGCGACACATTGCCCACGACGAGTGGCCTCGCAGCTACGACATCTCAGCAGCCTGGCCGTGGCTG
TCTGGCATCTGGACCACCGTCGTCGGGTGGCTCATGTTTCTCGCCCTTTGGCTGTTCAGCAGGCCGGTGCGGCAA
GGCGGGAGCAGAGGCCAGGGACGGGGGTGA
Transcript >Ophun1|3862
ATGGTGCAGCTCGCGGCTTCGACCTCGCGCCTTGGGCCCAACATGACGCCCAAGATGCTGGTCGAGTTTGTCAAG
GCTGGCGGCAACATGATGGTTGCTCTGTCTTCCACCACGCCCGCTCCCTCGTCTCTCGTCTCCATGTTGGCCGAG
TTCGAGGTGACGTTGCCGGTGGAGAGGACGGGGCTGGTGGTGGACCATTTCAACTACGATACTCTGTCGGCGGCG
CAGAAGCATGATGTGCTTGTCCTCGATGCACCCAGCAAGGCTCCTGTCGGCGTGACCGACTTGTTCGTCATGCCC
GGCACCGTCTTGGCCTTTCCGCGTACTTCTGGCCATCTACTCGGTCAGAGCCCGCTGTTGACGCCCCTGGTTCGC
GCCCCTTTTACTGCCTACAGTTACAATCCCAAGGAGCAGGCCGAGGGGATCGACCCGGATGACTTTTTCGGCGCT
GGCCAGCAGCTCAGTCTCGTGACGGCTATTCAGGCGCGCAACTCGGCTCGCATCGTCGTCGTCGGCTCGGCGGAG
ATGCTGCAGGATCAATGGATCGAGGCCAAAGTGGCGCACGTGGATAAGACGCCTGTCAAGGCGGGGAACCGCGAG
TTTGCAAAGAAGCTCACCGGCTGGGCGTTTCAGGAGATTGGCGTGTTGCGCGTCAACTCGATTGAGCATCATCTC
AAGGGATCCAAGGAGATGAATCCTGGCATTTACCGCATCAAGAACGACGTGTCGTTTACCATCTCCATGTCAGAG
TACTCGTGGGACAAGTGGGTGCCCTTCCAGGTTCCCAAGGACGACGATCTGCAGATGGAGTTTTCGATGCTCTCG
CCCTTTGTGCGTCTCAACCTTCGGAAGAAGAAGACGACCAAGACGGCAGCCATCTTCGGACGCGACTTTCAGCTA
CCGGATCAGCACGGCATCTTCAACTTCCTCGTCAACTACAAGCGGGAGCTCCTGACGTACGTGGACGAGAAGCGA
ACCGTCAGCGTGCGACACATTGCCCACGACGAGTGGCCTCGCAGCTACGACATCTCAGCAGCCTGGCCGTGGCTG
TCTGGCATCTGGACCACCGTCGTCGGGTGGCTCATGTTTCTCGCCCTTTGGCTGTTCAGCAGGCCGGTGCGGCAA
GGCGGGAGCAGAGGCCAGGGACGGGGGTGA
Gene >Ophun1|3862
ATGGTGCAGCTCGCGGCTTCGACCTCGCGTACGAGACGCCACGCAGTGAGACCATTCGTCTTTCCCGCCTCGGCG
AGCGAACCTACGATCACATCCTGTTTCTGCCCGTCAAGGTCAAAGGTAGCTGGCTCTCCAGTGTAGCCCAGGTTT
TATTCCATGCTTACCCGCACGACACAGGCCTTGGGCCCAACATGACGCCCAAGATGCTGGTCGAGTTTGTCAAGG
CTGGCGGCAACATGATGGTTGCTCTGTCTTCCACCACGCCCGCTCCCTCGTCTCTCGTCTCCATGTTGGCCGAGT
TCGAGGTGACGTTGCCGGTGGAGAGGACGGGGCTGGTGGTGGACCATTTCAACTACGATACTCTGTCGGCGGCGC
AGAAGCATGATGTGCTTGTCCTCGATGCACCCAGCAAGGCTCCTGTCGGCGTGACCGACTTGTTCGTCATGCCCG
GCACCGTCTTGGCCTTTCCGCGTACTTCTGGCCATCTACTCGGTCAGAGCCCGCTGTTGACGCCCCTGGTTCGCG
CCCCTTTTACTGCCTACAGTTACAATCCCAAGGAGCAGGCCGAGGGGATCGACCCGGATGACTTTTTCGGCGCTG
GCCAGCAGCTCAGTCTCGTGACGGCTATTCAGGCGCGCAACTCGGCTCGCATCGTCGTCGTCGGCTCGGCGGAGA
TGCTGCAGGATCAATGGATCGAGGCCAAAGTGGCGCACGTGGATAAGACGCCTGTCAAGGCGGGGAACCGCGAGT
TTGCAAAGAAGCTCACCGGCTGGGCGTTTCAGGAGATTGGCGTGTTGCGCGTCAACTCGATTGAGCATCATCTCA
AGGGATCCAAGGAGATGAATCCTGGCATTTACCGCATCAAGAACGACGTGGTGAGTGATTTTGCGATTGTGTTGT
CTGCTTCACGGATGCTATGGGTGCTAACTTGCGTTTTACAGTCGTTTACCATCTCCATGTCAGAGTACTCGTGGG
ACAAGTGGGTGCCCTTCCAGGTTCCCAAGGACGACGATCTGCAGATGGAGTTTTCGATGCTCTCGCCCTTTGTGC
GTCTCAACCTTCGGAAGAAGAAGACGACCAAGACGGCAGCCATCTTCGGACGCGACTTTCAGCTACCGGATCAGC
ACGGCATCTTCAACTTCCTCGTCAACTACAAGCGGGAGCTCCTGACGTACGTGGACGAGAAGCGAACCGTCAGCG
TGCGACACATTGCCCACGACGAGTGGCCTCGCAGCTACGACATCTCAGCAGCCTGGCCGTGGCTGTCTGGCATCT
GGACCACCGTCGTCGGGTGGCTCATGTTTCTCGCCCTTTGGCTGTTCAGCAGGCCGGTGCGGCAAGGCGGGAGCA
GAGGCCAGGGACGGGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail