Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3860
Gene name
LocationContig_348:18604..19265
Strand-
Gene length (bp)661
Transcript length (bp)570
Coding sequence length (bp)570
Protein length (aa) 190

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01625 PMSR Peptide methionine sulfoxide reductase 2.2E-58 24 176

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09859|MSRA_SCHPO Probable peptide methionine sulfoxide reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mxr1 PE=3 SV=2 22 182 9.0E-60
sp|P40029|MSRA_YEAST Peptide methionine sulfoxide reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MXR1 PE=1 SV=1 18 184 7.0E-52
sp|Q8TQV6|MSRA_METAC Peptide methionine sulfoxide reductase MsrA OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=msrA PE=3 SV=1 4 169 3.0E-50
sp|A3CUG3|MSRA_METMJ Peptide methionine sulfoxide reductase MsrA OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=msrA PE=3 SV=1 22 173 4.0E-48
sp|O26635|MSRA_METTH Peptide methionine sulfoxide reductase MsrA OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=msrA PE=3 SV=1 22 171 5.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09859|MSRA_SCHPO Probable peptide methionine sulfoxide reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mxr1 PE=3 SV=2 22 182 9.0E-60
sp|P40029|MSRA_YEAST Peptide methionine sulfoxide reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MXR1 PE=1 SV=1 18 184 7.0E-52
sp|Q8TQV6|MSRA_METAC Peptide methionine sulfoxide reductase MsrA OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=msrA PE=3 SV=1 4 169 3.0E-50
sp|A3CUG3|MSRA_METMJ Peptide methionine sulfoxide reductase MsrA OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=msrA PE=3 SV=1 22 173 4.0E-48
sp|O26635|MSRA_METTH Peptide methionine sulfoxide reductase MsrA OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=msrA PE=3 SV=1 22 171 5.0E-48
sp|Q8PUD6|MSRA_METMA Peptide methionine sulfoxide reductase MsrA OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=msrA PE=3 SV=1 19 170 9.0E-48
sp|C1F1B8|MSRA_ACIC5 Peptide methionine sulfoxide reductase MsrA OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=msrA PE=3 SV=1 23 169 9.0E-48
sp|B2HLR5|MSRA_MYCMM Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=msrA PE=3 SV=1 22 188 5.0E-46
sp|Q1B1N8|MSRA_MYCSS Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium sp. (strain MCS) GN=msrA PE=3 SV=1 22 176 6.0E-46
sp|A1UNG1|MSRA_MYCSK Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium sp. (strain KMS) GN=msrA PE=3 SV=1 22 176 6.0E-46
sp|A0PWH2|MSRA_MYCUA Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium ulcerans (strain Agy99) GN=msrA PE=3 SV=1 22 188 6.0E-46
sp|Q5YUS0|MSRA_NOCFA Peptide methionine sulfoxide reductase MsrA OS=Nocardia farcinica (strain IFM 10152) GN=msrA PE=3 SV=1 21 176 1.0E-45
sp|A3Q7V7|MSRA_MYCSJ Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium sp. (strain JLS) GN=msrA PE=3 SV=1 22 176 2.0E-45
sp|Q3SU08|MSRA_NITWN Peptide methionine sulfoxide reductase MsrA OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=msrA PE=3 SV=1 22 188 2.0E-45
sp|Q98JV5|MSRA1_RHILO Peptide methionine sulfoxide reductase MsrA 1 OS=Rhizobium loti (strain MAFF303099) GN=msrA1 PE=3 SV=1 17 188 2.0E-45
sp|P54152|MSRA_FRAAN Peptide methionine sulfoxide reductase OS=Fragaria ananassa PE=2 SV=2 1 173 3.0E-45
sp|Q7UJK0|MSRA1_RHOBA Peptide methionine sulfoxide reductase MsrA 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=msrA1 PE=3 SV=2 20 184 1.0E-44
sp|Q18J40|MSRA_HALWD Peptide methionine sulfoxide reductase MsrA OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=msrA PE=3 SV=1 21 179 1.0E-44
sp|A1TH24|MSRA_MYCVP Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=msrA PE=3 SV=1 22 176 4.0E-44
sp|A4T413|MSRA_MYCGI Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium gilvum (strain PYR-GCK) GN=msrA PE=3 SV=1 22 176 5.0E-44
sp|Q7UJI2|MSRA2_RHOBA Peptide methionine sulfoxide reductase MsrA 2 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=msrA2 PE=3 SV=1 21 176 7.0E-44
sp|Q73U14|MSRA_MYCPA Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=msrA PE=3 SV=1 20 188 8.0E-44
sp|P54153|MSRA_SOLLC Peptide methionine sulfoxide reductase (Fragment) OS=Solanum lycopersicum GN=E4 PE=3 SV=1 3 172 1.0E-43
sp|P9WJM5|MSRA_MYCTU Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=msrA PE=1 SV=1 22 182 1.0E-43
sp|P9WJM4|MSRA_MYCTO Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=msrA PE=3 SV=1 22 182 1.0E-43
sp|A5TYL2|MSRA_MYCTA Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=msrA PE=3 SV=1 22 182 1.0E-43
sp|C1AJG2|MSRA_MYCBT Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=msrA PE=3 SV=1 22 182 1.0E-43
sp|A1KEV7|MSRA_MYCBP Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=msrA PE=3 SV=1 22 182 1.0E-43
sp|P0A5L1|MSRA_MYCBO Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=msrA PE=3 SV=1 22 182 1.0E-43
sp|O69761|MSRA_PSEFL Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas fluorescens GN=msrA PE=3 SV=1 22 182 1.0E-43
sp|Q9CCZ3|MSRA_MYCLE Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium leprae (strain TN) GN=msrA PE=3 SV=1 20 188 2.0E-43
sp|B8ZTJ5|MSRA_MYCLB Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium leprae (strain Br4923) GN=msrA PE=3 SV=1 20 188 2.0E-43
sp|Q6AG94|MSRA_LEIXX Peptide methionine sulfoxide reductase MsrA OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=msrA PE=3 SV=1 22 176 2.0E-43
sp|Q7XUP7|MSR21_ORYSJ Peptide methionine sulfoxide reductase A2-1 OS=Oryza sativa subsp. japonica GN=MSRA2-1 PE=2 SV=2 2 169 4.0E-43
sp|Q4J9L3|MSRA_SULAC Peptide methionine sulfoxide reductase MsrA OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=msrA PE=3 SV=2 25 172 5.0E-43
sp|Q9EWF7|MSRA_STRCO Peptide methionine sulfoxide reductase MsrA OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=msrA PE=3 SV=1 22 176 5.0E-43
sp|Q551H3|MSRA_DICDI Peptide methionine sulfoxide reductase OS=Dictyostelium discoideum GN=msrA PE=3 SV=1 23 167 6.0E-43
sp|Q39Z11|MSRA_GEOMG Peptide methionine sulfoxide reductase MsrA OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=msrA PE=3 SV=1 12 173 7.0E-43
sp|O83641|MSRAB_TREPA Peptide methionine sulfoxide reductase MsrB/MsrA OS=Treponema pallidum (strain Nichols) GN=msrAB PE=3 SV=1 26 174 1.0E-42
sp|Q119G2|MSRA_TRIEI Peptide methionine sulfoxide reductase MsrA OS=Trichodesmium erythraeum (strain IMS101) GN=msrA PE=3 SV=1 25 171 2.0E-42
sp|Q9RTB6|MSRA_DEIRA Peptide methionine sulfoxide reductase MsrA OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=msrA PE=3 SV=1 2 180 9.0E-42
sp|Q2FQ35|MSRA_METHJ Peptide methionine sulfoxide reductase MsrA OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=msrA PE=3 SV=1 26 169 1.0E-41
sp|Q92Y45|MSRA3_RHIME Peptide methionine sulfoxide reductase MsrA 3 OS=Rhizobium meliloti (strain 1021) GN=msrA3 PE=1 SV=1 21 176 1.0E-41
sp|Q82I51|MSRA_STRAW Peptide methionine sulfoxide reductase MsrA OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=msrA PE=3 SV=1 22 176 2.0E-41
sp|Q747V4|MSRA_GEOSL Peptide methionine sulfoxide reductase MsrA OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=msrA PE=3 SV=1 22 173 3.0E-41
sp|P54150|MSRA4_ARATH Peptide methionine sulfoxide reductase A4, chloroplastic OS=Arabidopsis thaliana GN=MSR4 PE=1 SV=2 5 169 1.0E-40
sp|A6TUE9|MSRA_ALKMQ Peptide methionine sulfoxide reductase MsrA OS=Alkaliphilus metalliredigens (strain QYMF) GN=msrA PE=3 SV=1 22 174 2.0E-40
sp|A4SWL6|MSRA_POLSQ Peptide methionine sulfoxide reductase MsrA OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=msrA PE=3 SV=1 14 171 2.0E-40
sp|Q9LY14|MSRA3_ARATH Peptide methionine sulfoxide reductase A3 OS=Arabidopsis thaliana GN=MSRA3 PE=1 SV=1 8 169 4.0E-40
sp|Q12TP4|MSRA_METBU Peptide methionine sulfoxide reductase MsrA OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=msrA PE=3 SV=1 22 169 6.0E-40
sp|P54151|MSRA_BRANA Peptide methionine sulfoxide reductase OS=Brassica napus GN=PMSR PE=2 SV=1 3 169 6.0E-40
sp|Q9FKF7|MSRA1_ARATH Peptide methionine sulfoxide reductase A1 OS=Arabidopsis thaliana GN=MSRA1 PE=2 SV=1 8 169 1.0E-39
sp|B1LRA3|MSRA_ECOSM Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=msrA PE=3 SV=1 1 174 1.0E-39
sp|Q2RRT3|MSRA_RHORT Peptide methionine sulfoxide reductase MsrA OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=msrA PE=3 SV=1 25 170 3.0E-39
sp|A8M3K6|MSRA_SALAI Peptide methionine sulfoxide reductase MsrA OS=Salinispora arenicola (strain CNS-205) GN=msrA PE=3 SV=1 16 182 6.0E-39
sp|B7UQN3|MSRA_ECO27 Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=msrA PE=3 SV=1 1 171 6.0E-39
sp|Q9CN40|MSRA_PASMU Peptide methionine sulfoxide reductase MsrA OS=Pasteurella multocida (strain Pm70) GN=msrA PE=3 SV=1 22 176 7.0E-39
sp|Q04PP8|MSRA_LEPBJ Peptide methionine sulfoxide reductase MsrA OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=msrA PE=3 SV=1 22 176 8.0E-39
sp|A8G8X6|MSRA_SERP5 Peptide methionine sulfoxide reductase MsrA OS=Serratia proteamaculans (strain 568) GN=msrA PE=3 SV=1 1 174 8.0E-39
sp|Q9LY15|MSRA2_ARATH Peptide methionine sulfoxide reductase A2 OS=Arabidopsis thaliana GN=MRSA2 PE=1 SV=1 2 183 9.0E-39
sp|C3KXI0|MSRA_CLOB6 Peptide methionine sulfoxide reductase MsrA OS=Clostridium botulinum (strain 657 / Type Ba4) GN=msrA PE=3 SV=1 22 180 1.0E-38
sp|A5CWI5|MSRA_VESOH Peptide methionine sulfoxide reductase MsrA OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=msrA PE=3 SV=1 21 170 1.0E-38
sp|C1FPF1|MSRA_CLOBJ Peptide methionine sulfoxide reductase MsrA OS=Clostridium botulinum (strain Kyoto / Type A2) GN=msrA PE=3 SV=1 21 180 1.0E-38
sp|A5I348|MSRA_CLOBH Peptide methionine sulfoxide reductase MsrA OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=msrA PE=3 SV=1 21 180 1.0E-38
sp|A7FUX9|MSRA_CLOB1 Peptide methionine sulfoxide reductase MsrA OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=msrA PE=3 SV=1 21 180 1.0E-38
sp|B6I2D2|MSRA_ECOSE Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli (strain SE11) GN=msrA PE=3 SV=1 1 171 1.0E-38
sp|A1AWS4|MSRA_RUTMC Peptide methionine sulfoxide reductase MsrA OS=Ruthia magnifica subsp. Calyptogena magnifica GN=msrA PE=3 SV=1 26 172 2.0E-38
sp|B7NGF6|MSRA_ECOLU Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=msrA PE=3 SV=1 1 171 2.0E-38
sp|B7MTA1|MSRA_ECO81 Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O81 (strain ED1a) GN=msrA PE=3 SV=1 1 171 2.0E-38
sp|B7NUD2|MSRA_ECO7I Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=msrA PE=3 SV=1 1 171 2.0E-38
sp|B5Z3H5|MSRA_ECO5E Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=msrA PE=3 SV=1 1 171 3.0E-38
sp|Q8XCG3|MSRA_ECO57 Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O157:H7 GN=msrA PE=3 SV=3 1 171 3.0E-38
sp|Q9HQG0|MSRA_HALSA Peptide methionine sulfoxide reductase MsrA OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=msrA PE=3 SV=1 20 180 3.0E-38
sp|B0R518|MSRA_HALS3 Peptide methionine sulfoxide reductase MsrA OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=msrA PE=3 SV=1 20 180 3.0E-38
sp|Q9SEC2|MSRA_LACSA Peptide methionine sulfoxide reductase OS=Lactuca sativa PE=2 SV=1 5 169 3.0E-38
sp|Q328B8|MSRA_SHIDS Peptide methionine sulfoxide reductase MsrA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msrA PE=3 SV=1 1 171 3.0E-38
sp|B1IMT7|MSRA_CLOBK Peptide methionine sulfoxide reductase MsrA OS=Clostridium botulinum (strain Okra / Type B1) GN=msrA PE=3 SV=1 22 180 4.0E-38
sp|A1JIU0|MSRA_YERE8 Peptide methionine sulfoxide reductase MsrA OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=msrA PE=3 SV=1 1 174 5.0E-38
sp|A4X3E5|MSRA_SALTO Peptide methionine sulfoxide reductase MsrA OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=msrA PE=3 SV=1 1 182 8.0E-38
sp|B5Y2Y3|MSRA_KLEP3 Peptide methionine sulfoxide reductase MsrA OS=Klebsiella pneumoniae (strain 342) GN=msrA PE=3 SV=1 1 186 9.0E-38
sp|Q3YUC8|MSRA_SHISS Peptide methionine sulfoxide reductase MsrA OS=Shigella sonnei (strain Ss046) GN=msrA PE=3 SV=1 1 171 1.0E-37
sp|P0A745|MSRA_SHIFL Peptide methionine sulfoxide reductase MsrA OS=Shigella flexneri GN=msrA PE=3 SV=2 1 171 1.0E-37
sp|Q0SXG5|MSRA_SHIF8 Peptide methionine sulfoxide reductase MsrA OS=Shigella flexneri serotype 5b (strain 8401) GN=msrA PE=3 SV=1 1 171 1.0E-37
sp|B2TZL3|MSRA_SHIB3 Peptide methionine sulfoxide reductase MsrA OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=msrA PE=3 SV=1 1 171 1.0E-37
sp|P0A744|MSRA_ECOLI Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli (strain K12) GN=msrA PE=1 SV=2 1 171 1.0E-37
sp|B1ISY2|MSRA_ECOLC Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=msrA PE=3 SV=1 1 171 1.0E-37
sp|A8A7X5|MSRA_ECOHS Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O9:H4 (strain HS) GN=msrA PE=3 SV=1 1 171 1.0E-37
sp|B1XDW8|MSRA_ECODH Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli (strain K12 / DH10B) GN=msrA PE=3 SV=1 1 171 1.0E-37
sp|C4ZR95|MSRA_ECOBW Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=msrA PE=3 SV=1 1 171 1.0E-37
sp|B7M9I1|MSRA_ECO8A Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O8 (strain IAI1) GN=msrA PE=3 SV=1 1 171 1.0E-37
sp|B7LCT1|MSRA_ECO55 Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli (strain 55989 / EAEC) GN=msrA PE=3 SV=1 1 171 1.0E-37
sp|B7MLN1|MSRA_ECO45 Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=msrA PE=3 SV=1 1 171 1.0E-37
sp|A7ZV98|MSRA_ECO24 Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=msrA PE=3 SV=1 1 171 1.0E-37
sp|Q3IUS0|MSRA_NATPD Peptide methionine sulfoxide reductase MsrA OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=msrA PE=3 SV=1 25 179 1.0E-37
sp|B0VL72|MSRA_ACIBS Peptide methionine sulfoxide reductase MsrA OS=Acinetobacter baumannii (strain SDF) GN=msrA PE=3 SV=1 22 176 1.0E-37
sp|B0V4P7|MSRA_ACIBY Peptide methionine sulfoxide reductase MsrA OS=Acinetobacter baumannii (strain AYE) GN=msrA PE=3 SV=1 22 176 1.0E-37
sp|B2I399|MSRA_ACIBC Peptide methionine sulfoxide reductase MsrA OS=Acinetobacter baumannii (strain ACICU) GN=msrA PE=3 SV=1 22 176 1.0E-37
sp|B7I4T7|MSRA_ACIB5 Peptide methionine sulfoxide reductase MsrA OS=Acinetobacter baumannii (strain AB0057) GN=msrA PE=3 SV=1 22 176 1.0E-37
sp|B7H0P7|MSRA_ACIB3 Peptide methionine sulfoxide reductase MsrA OS=Acinetobacter baumannii (strain AB307-0294) GN=msrA PE=3 SV=1 22 176 1.0E-37
sp|Q0T9G6|MSRA_ECOL5 Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msrA PE=3 SV=1 1 171 1.0E-37
sp|Q8Y1C6|MSRA_RALSO Peptide methionine sulfoxide reductase MsrA OS=Ralstonia solanacearum (strain GMI1000) GN=msrA PE=3 SV=1 19 176 1.0E-37
sp|Q055M2|MSRA_LEPBL Peptide methionine sulfoxide reductase MsrA OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=msrA PE=3 SV=1 22 176 2.0E-37
sp|Q97Y45|MSRA_SULSO Peptide methionine sulfoxide reductase MsrA OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=msrA PE=3 SV=1 25 170 2.0E-37
sp|B2VHZ5|MSRA_ERWT9 Peptide methionine sulfoxide reductase MsrA OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=msrA PE=3 SV=1 26 166 3.0E-37
sp|Q899M3|MSRA_CLOTE Peptide methionine sulfoxide reductase MsrA OS=Clostridium tetani (strain Massachusetts / E88) GN=msrA PE=3 SV=1 21 174 3.0E-37
sp|Q8FAG4|MSRA_ECOL6 Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msrA PE=3 SV=3 1 171 3.0E-37
sp|Q6LYY1|MSRA_METMP Peptide methionine sulfoxide reductase MsrA OS=Methanococcus maripaludis (strain S2 / LL) GN=msrA PE=3 SV=1 19 169 3.0E-37
sp|A7GEN6|MSRA_CLOBL Peptide methionine sulfoxide reductase MsrA OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=msrA PE=3 SV=1 22 180 3.0E-37
sp|Q6D151|MSRA_PECAS Peptide methionine sulfoxide reductase MsrA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msrA PE=3 SV=1 17 174 4.0E-37
sp|A3M1W6|MSRA_ACIBT Peptide methionine sulfoxide reductase MsrA OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=msrA PE=3 SV=2 22 176 4.0E-37
sp|Q31TF9|MSRA_SHIBS Peptide methionine sulfoxide reductase MsrA OS=Shigella boydii serotype 4 (strain Sb227) GN=msrA PE=3 SV=1 1 171 4.0E-37
sp|C6DDM6|MSRA_PECCP Peptide methionine sulfoxide reductase MsrA OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=msrA PE=3 SV=1 17 174 4.0E-37
sp|Q4FP80|MSRA_PELUB Peptide methionine sulfoxide reductase MsrA OS=Pelagibacter ubique (strain HTCC1062) GN=msrA PE=3 SV=1 25 169 5.0E-37
sp|A7MM56|MSRA_CROS8 Peptide methionine sulfoxide reductase MsrA OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=msrA PE=3 SV=1 17 171 6.0E-37
sp|Q7XUP6|MSR22_ORYSJ Peptide methionine sulfoxide reductase A2-2 OS=Oryza sativa subsp. japonica GN=MSRA2-2 PE=2 SV=2 12 170 8.0E-37
sp|B1KU02|MSRA_CLOBM Peptide methionine sulfoxide reductase MsrA OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=msrA PE=3 SV=1 22 180 8.0E-37
sp|Q87SW6|MSRA_VIBPA Peptide methionine sulfoxide reductase MsrA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msrA PE=3 SV=1 11 186 9.0E-37
sp|Q8YXZ4|MSRA1_NOSS1 Peptide methionine sulfoxide reductase MsrA 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=msrA1 PE=3 SV=1 22 170 1.0E-36
sp|Q9ZEQ8|MSRA_DICD3 Peptide methionine sulfoxide reductase MsrA OS=Dickeya dadantii (strain 3937) GN=msrA PE=3 SV=1 17 174 1.0E-36
sp|Q0ATD8|MSRA_MARMM Peptide methionine sulfoxide reductase MsrA OS=Maricaulis maris (strain MCS10) GN=msrA PE=3 SV=1 2 174 3.0E-36
sp|B7K079|MSRA_CYAP8 Peptide methionine sulfoxide reductase MsrA OS=Cyanothece sp. (strain PCC 8801) GN=msrA PE=3 SV=1 14 174 4.0E-36
sp|B7LMP0|MSRA_ESCF3 Peptide methionine sulfoxide reductase MsrA OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=msrA PE=3 SV=1 1 171 4.0E-36
sp|P72800|MSRA2_SYNY3 Peptide methionine sulfoxide reductase MsrA 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=msrA2 PE=3 SV=1 9 187 5.0E-36
sp|A9MEZ2|MSRA_SALAR Peptide methionine sulfoxide reductase MsrA OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=msrA PE=3 SV=1 1 174 5.0E-36
sp|Q336R9|MSRA4_ORYSJ Peptide methionine sulfoxide reductase A4, chloroplastic OS=Oryza sativa subsp. japonica GN=MSRA4 PE=2 SV=2 13 169 5.0E-36
sp|C3LRL2|MSRA_VIBCM Peptide methionine sulfoxide reductase MsrA OS=Vibrio cholerae serotype O1 (strain M66-2) GN=msrA PE=3 SV=1 3 186 5.0E-36
sp|Q9KP30|MSRA_VIBCH Peptide methionine sulfoxide reductase MsrA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msrA PE=3 SV=1 3 186 5.0E-36
sp|A5F587|MSRA_VIBC3 Peptide methionine sulfoxide reductase MsrA OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=msrA PE=3 SV=1 3 186 5.0E-36
sp|Q8DE84|MSRA_VIBVU Peptide methionine sulfoxide reductase MsrA OS=Vibrio vulnificus (strain CMCP6) GN=msrA PE=3 SV=1 11 186 6.0E-36
sp|A5CQY7|MSRA_CLAM3 Peptide methionine sulfoxide reductase MsrA OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=msrA PE=3 SV=1 22 181 1.0E-35
sp|Q21JK7|MSRA_SACD2 Peptide methionine sulfoxide reductase MsrA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msrA PE=3 SV=1 15 174 1.0E-35
sp|Q8EVK2|MSRA_MYCPE Peptide methionine sulfoxide reductase MsrA OS=Mycoplasma penetrans (strain HF-2) GN=msrA PE=3 SV=1 22 174 2.0E-35
sp|Q2W5W8|MSRA_MAGSA Peptide methionine sulfoxide reductase MsrA OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=msrA PE=3 SV=1 14 171 2.0E-35
sp|P72622|MSRA1_SYNY3 Peptide methionine sulfoxide reductase MsrA 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=msrA1 PE=3 SV=1 16 174 3.0E-35
sp|A4W5V5|MSRA_ENT38 Peptide methionine sulfoxide reductase MsrA OS=Enterobacter sp. (strain 638) GN=msrA PE=3 SV=1 1 186 5.0E-35
sp|Q0BPD5|MSRA_GRABC Peptide methionine sulfoxide reductase MsrA OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=msrA PE=3 SV=1 22 184 5.0E-35
sp|Q8FLU6|MSRA_COREF Peptide methionine sulfoxide reductase MsrA OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=msrA PE=3 SV=2 16 179 6.0E-35
sp|B0RBB1|MSRA_CLAMS Peptide methionine sulfoxide reductase MsrA OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=msrA PE=3 SV=1 22 181 7.0E-35
sp|Q746G0|MSRA_THET2 Peptide methionine sulfoxide reductase MsrA OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=msrA PE=3 SV=1 25 176 7.0E-35
sp|Q53W34|MSRA_THET8 Peptide methionine sulfoxide reductase MsrA OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=msrA PE=3 SV=1 25 176 8.0E-35
sp|A4QHY3|MSRA_CORGB Peptide methionine sulfoxide reductase MsrA OS=Corynebacterium glutamicum (strain R) GN=msrA PE=3 SV=1 16 179 9.0E-35
sp|Q7MYW1|MSRA_PHOLL Peptide methionine sulfoxide reductase MsrA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msrA PE=3 SV=1 16 174 1.0E-34
sp|Q8NLL5|MSRA_CORGL Peptide methionine sulfoxide reductase MsrA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=msrA PE=3 SV=1 16 179 1.0E-34
sp|Q7NVL7|MSRA_CHRVO Peptide methionine sulfoxide reductase MsrA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=msrA PE=3 SV=1 22 163 2.0E-34
sp|Q9APY4|MSRA_CORML Peptide methionine sulfoxide reductase MsrA OS=Corynebacterium melassecola GN=msrA PE=3 SV=1 16 179 2.0E-34
sp|Q0SPW9|MSRA_CLOPS Peptide methionine sulfoxide reductase MsrA OS=Clostridium perfringens (strain SM101 / Type A) GN=msrA PE=3 SV=1 22 183 2.0E-34
sp|C4LG69|MSRA_CORK4 Peptide methionine sulfoxide reductase MsrA OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=msrA PE=3 SV=1 14 179 3.0E-34
sp|Q0TM63|MSRA_CLOP1 Peptide methionine sulfoxide reductase MsrA OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=msrA PE=3 SV=1 21 183 3.0E-34
sp|Q8XH97|MSRA_CLOPE Peptide methionine sulfoxide reductase MsrA OS=Clostridium perfringens (strain 13 / Type A) GN=msrA PE=3 SV=1 22 183 5.0E-34
sp|Q97MV3|MSRA_CLOAB Peptide methionine sulfoxide reductase MsrA OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=msrA PE=3 SV=1 22 174 5.0E-34
sp|Q8YWD8|MSRA2_NOSS1 Peptide methionine sulfoxide reductase MsrA 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=msrA2 PE=3 SV=1 1 174 5.0E-34
sp|A9N540|MSRA_SALPB Peptide methionine sulfoxide reductase MsrA OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=msrA PE=3 SV=1 1 171 6.0E-34
sp|B6IS04|MSRA_RHOCS Peptide methionine sulfoxide reductase MsrA OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=msrA PE=3 SV=1 14 174 6.0E-34
sp|A6VFD6|MSRA_METM7 Peptide methionine sulfoxide reductase MsrA OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=msrA PE=3 SV=1 20 169 7.0E-34
sp|Q6L2S4|MSRA_PICTO Peptide methionine sulfoxide reductase MsrA OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=msrA PE=3 SV=1 24 171 8.0E-34
sp|B1JML1|MSRA_YERPY Peptide methionine sulfoxide reductase MsrA OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=msrA PE=3 SV=1 17 174 9.0E-34
sp|Q66F89|MSRA_YERPS Peptide methionine sulfoxide reductase MsrA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msrA PE=3 SV=1 17 174 9.0E-34
sp|A4TRL2|MSRA_YERPP Peptide methionine sulfoxide reductase MsrA OS=Yersinia pestis (strain Pestoides F) GN=msrA PE=3 SV=1 17 174 9.0E-34
sp|Q1CEI4|MSRA_YERPN Peptide methionine sulfoxide reductase MsrA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msrA PE=3 SV=1 17 174 9.0E-34
sp|A9R574|MSRA_YERPG Peptide methionine sulfoxide reductase MsrA OS=Yersinia pestis bv. Antiqua (strain Angola) GN=msrA PE=3 SV=1 17 174 9.0E-34
sp|Q8ZB94|MSRA_YERPE Peptide methionine sulfoxide reductase MsrA OS=Yersinia pestis GN=msrA PE=3 SV=1 17 174 9.0E-34
sp|B2K2M6|MSRA_YERPB Peptide methionine sulfoxide reductase MsrA OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=msrA PE=3 SV=1 17 174 9.0E-34
sp|Q1CBX8|MSRA_YERPA Peptide methionine sulfoxide reductase MsrA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msrA PE=3 SV=1 17 174 9.0E-34
sp|A7FMV2|MSRA_YERP3 Peptide methionine sulfoxide reductase MsrA OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=msrA PE=3 SV=1 17 174 9.0E-34
sp|B9LA36|MSRA_NAUPA Peptide methionine sulfoxide reductase MsrA OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=msrA PE=3 SV=1 23 171 1.0E-33
sp|B4TT49|MSRA_SALSV Peptide methionine sulfoxide reductase MsrA OS=Salmonella schwarzengrund (strain CVM19633) GN=msrA PE=3 SV=1 1 171 3.0E-33
sp|Q1Q8I3|MSRA_PSYCK Peptide methionine sulfoxide reductase MsrA OS=Psychrobacter cryohalolentis (strain K5) GN=msrA PE=3 SV=1 22 176 3.0E-33
sp|A8IPQ8|MSRA_AZOC5 Peptide methionine sulfoxide reductase MsrA OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=msrA PE=3 SV=1 16 171 3.0E-33
sp|Q602T2|MSRA_METCA Peptide methionine sulfoxide reductase MsrA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=msrA PE=3 SV=1 15 177 3.0E-33
sp|Q8ZK71|MSRA_SALTY Peptide methionine sulfoxide reductase MsrA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=msrA PE=3 SV=1 1 171 3.0E-33
sp|B4T3H1|MSRA_SALNS Peptide methionine sulfoxide reductase MsrA OS=Salmonella newport (strain SL254) GN=msrA PE=3 SV=1 1 171 3.0E-33
sp|Q4FQB0|MSRA_PSYA2 Peptide methionine sulfoxide reductase MsrA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msrA PE=3 SV=1 22 176 4.0E-33
sp|B5F3D4|MSRA_SALA4 Peptide methionine sulfoxide reductase MsrA OS=Salmonella agona (strain SL483) GN=msrA PE=3 SV=1 1 171 4.0E-33
sp|A9AB97|MSRA_METM6 Peptide methionine sulfoxide reductase MsrA OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=msrA PE=3 SV=1 20 169 7.0E-33
sp|B1JE82|MSRA_PSEPW Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas putida (strain W619) GN=msrA PE=3 SV=1 26 174 8.0E-33
sp|C1DGW5|MSRA_AZOVD Peptide methionine sulfoxide reductase MsrA OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=msrA PE=3 SV=1 14 171 8.0E-33
sp|Q57GH3|MSRA_SALCH Peptide methionine sulfoxide reductase MsrA OS=Salmonella choleraesuis (strain SC-B67) GN=msrA PE=3 SV=1 1 171 9.0E-33
sp|A4FYX5|MSRA_METM5 Peptide methionine sulfoxide reductase MsrA OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=msrA PE=3 SV=1 20 169 9.0E-33
sp|Q8Z150|MSRA_SALTI Peptide methionine sulfoxide reductase MsrA OS=Salmonella typhi GN=msrA PE=3 SV=1 1 171 9.0E-33
sp|B5BKM8|MSRA_SALPK Peptide methionine sulfoxide reductase MsrA OS=Salmonella paratyphi A (strain AKU_12601) GN=msrA PE=3 SV=1 1 171 9.0E-33
sp|C0Q6H8|MSRA_SALPC Peptide methionine sulfoxide reductase MsrA OS=Salmonella paratyphi C (strain RKS4594) GN=msrA PE=3 SV=1 1 171 9.0E-33
sp|Q5PJ81|MSRA_SALPA Peptide methionine sulfoxide reductase MsrA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=msrA PE=3 SV=1 1 171 9.0E-33
sp|B4TFF2|MSRA_SALHS Peptide methionine sulfoxide reductase MsrA OS=Salmonella heidelberg (strain SL476) GN=msrA PE=3 SV=1 1 171 9.0E-33
sp|B5R9G7|MSRA_SALG2 Peptide methionine sulfoxide reductase MsrA OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=msrA PE=3 SV=1 1 171 9.0E-33
sp|B5R0T7|MSRA_SALEP Peptide methionine sulfoxide reductase MsrA OS=Salmonella enteritidis PT4 (strain P125109) GN=msrA PE=3 SV=1 1 171 9.0E-33
sp|B5FSB9|MSRA_SALDC Peptide methionine sulfoxide reductase MsrA OS=Salmonella dublin (strain CT_02021853) GN=msrA PE=3 SV=1 1 171 9.0E-33
sp|B1W2P8|MSRA_STRGG Peptide methionine sulfoxide reductase MsrA OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=msrA PE=3 SV=1 16 171 1.0E-32
sp|Q9PHN0|MSRA_CAMJE Peptide methionine sulfoxide reductase MsrA OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=mrsA PE=1 SV=1 21 180 1.0E-32
sp|A1VYZ7|MSRA_CAMJJ Peptide methionine sulfoxide reductase MsrA OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=msrA PE=3 SV=1 21 180 1.0E-32
sp|Q5HVD4|MSRA_CAMJR Peptide methionine sulfoxide reductase MsrA OS=Campylobacter jejuni (strain RM1221) GN=msrA PE=3 SV=1 21 180 1.0E-32
sp|A8FL58|MSRA_CAMJ8 Peptide methionine sulfoxide reductase MsrA OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=msrA PE=3 SV=1 21 180 1.0E-32
sp|Q88QZ8|MSRA_PSEPK Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas putida (strain KT2440) GN=msrA PE=3 SV=1 1 174 1.0E-32
sp|Q9A9I6|MSRA1_CAUCR Peptide methionine sulfoxide reductase MsrA 1 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=msrA1 PE=3 SV=1 16 174 1.0E-32
sp|Q98DV6|MSRA2_RHILO Peptide methionine sulfoxide reductase MsrA 2 OS=Rhizobium loti (strain MAFF303099) GN=msrA2 PE=3 SV=1 20 187 2.0E-32
sp|B0KJ25|MSRA_PSEPG Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas putida (strain GB-1) GN=msrA PE=3 SV=1 16 174 3.0E-32
sp|P54149|MSRA_BOVIN Mitochondrial peptide methionine sulfoxide reductase OS=Bos taurus GN=MSRA PE=1 SV=2 16 174 3.0E-32
sp|A6Q418|MSRA_NITSB Peptide methionine sulfoxide reductase MsrA OS=Nitratiruptor sp. (strain SB155-2) GN=msrA PE=3 SV=1 21 171 5.0E-32
sp|Q1I3L0|MSRA_PSEE4 Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas entomophila (strain L48) GN=msrA PE=3 SV=1 26 174 5.0E-32
sp|Q6LV65|MSRA_PHOPR Peptide methionine sulfoxide reductase MsrA OS=Photobacterium profundum GN=msrA PE=3 SV=1 18 174 8.0E-32
sp|Q4ZM24|MSRA_PSEU2 Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=msrA PE=3 SV=1 16 174 8.0E-32
sp|Q92SY7|MSRA1_RHIME Peptide methionine sulfoxide reductase MsrA 1 OS=Rhizobium meliloti (strain 1021) GN=msrA1 PE=3 SV=1 1 174 9.0E-32
sp|Q9K1N8|MSRAB_NEIMB Peptide methionine sulfoxide reductase MsrA/MsrB OS=Neisseria meningitidis serogroup B (strain MC58) GN=msrAB PE=3 SV=1 26 188 9.0E-32
sp|Q9JWM8|MSRAB_NEIMA Peptide methionine sulfoxide reductase MsrA/MsrB OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=msrAB PE=1 SV=1 26 188 9.0E-32
sp|Q7D255|MSRA_AGRFC Peptide methionine sulfoxide reductase MsrA OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=msrA PE=3 SV=2 16 174 1.0E-31
sp|Q9UJ68|MSRA_HUMAN Mitochondrial peptide methionine sulfoxide reductase OS=Homo sapiens GN=MSRA PE=1 SV=1 16 174 1.0E-31
sp|A7H4H5|MSRA_CAMJD Peptide methionine sulfoxide reductase MsrA OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=msrA PE=3 SV=1 21 180 1.0E-31
sp|Q48CJ2|MSRA_PSE14 Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=msrA PE=3 SV=1 16 174 1.0E-31
sp|P14930|MSRAB_NEIGO Peptide methionine sulfoxide reductase MsrA/MsrB OS=Neisseria gonorrhoeae GN=msrAB PE=1 SV=2 26 188 2.0E-31
sp|Q923M1|MSRA_RAT Mitochondrial peptide methionine sulfoxide reductase OS=Rattus norvegicus GN=Msra PE=1 SV=1 16 182 3.0E-31
sp|A8L177|MSRA_FRASN Peptide methionine sulfoxide reductase MsrA OS=Frankia sp. (strain EAN1pec) GN=msrA PE=3 SV=1 16 174 4.0E-31
sp|Q9D6Y7|MSRA_MOUSE Mitochondrial peptide methionine sulfoxide reductase OS=Mus musculus GN=Msra PE=1 SV=1 16 174 6.0E-31
sp|A4XPS6|MSRA_PSEMY Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas mendocina (strain ymp) GN=msrA PE=3 SV=1 14 188 9.0E-31
sp|Q9KLX6|MSRAB_VIBCH Peptide methionine sulfoxide reductase MsrA/MsrB OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msrAB PE=3 SV=2 22 175 9.0E-31
sp|B0UCG5|MSRA_METS4 Peptide methionine sulfoxide reductase MsrA OS=Methylobacterium sp. (strain 4-46) GN=msrA PE=3 SV=1 16 174 1.0E-30
sp|Q93S39|MSRA_OCHAN Peptide methionine sulfoxide reductase MsrA OS=Ochrobactrum anthropi GN=msrA PE=2 SV=1 1 174 1.0E-30
sp|Q9ZMK8|MSRAB_HELPJ Peptide methionine sulfoxide reductase MsrA/MsrB OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=msrAB PE=3 SV=1 16 174 2.0E-30
sp|Q6NEL2|MSRA_CORDI Peptide methionine sulfoxide reductase MsrA OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=msrA PE=1 SV=1 20 179 2.0E-30
sp|A6WYH5|MSRA_OCHA4 Peptide methionine sulfoxide reductase MsrA OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=msrA PE=3 SV=1 1 174 2.0E-30
sp|A2RG28|MSRA_STRPG Peptide methionine sulfoxide reductase MsrA OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=msrA PE=3 SV=1 22 184 3.0E-30
sp|Q8P272|MSRA_STRP8 Peptide methionine sulfoxide reductase MsrA OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=msrA PE=3 SV=1 22 184 3.0E-30
sp|Q5XDH1|MSRA_STRP6 Peptide methionine sulfoxide reductase MsrA OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=msrA PE=3 SV=1 22 184 3.0E-30
sp|P0DC39|MSRA_STRPQ Peptide methionine sulfoxide reductase MsrA OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=msrA.2 PE=3 SV=1 22 184 4.0E-30
sp|P0DC38|MSRA_STRP3 Peptide methionine sulfoxide reductase MsrA OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=msrA.2 PE=3 SV=1 22 184 4.0E-30
sp|C0RMK6|MSRA_BRUMB Peptide methionine sulfoxide reductase MsrA OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=msrA PE=3 SV=1 16 174 4.0E-30
sp|B8HA70|MSRA_ARTCA Peptide methionine sulfoxide reductase MsrA OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=msrA PE=3 SV=1 25 171 4.0E-30
sp|Q8YDE7|MSRA_BRUME Peptide methionine sulfoxide reductase MsrA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=msrA PE=3 SV=1 16 174 4.0E-30
sp|Q8FUZ0|MSRA_BRUSU Peptide methionine sulfoxide reductase MsrA OS=Brucella suis biovar 1 (strain 1330) GN=msrA PE=3 SV=1 16 174 4.0E-30
sp|A9WW77|MSRA_BRUSI Peptide methionine sulfoxide reductase MsrA OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=msrA PE=3 SV=1 16 174 5.0E-30
sp|A5VVX1|MSRA_BRUO2 Peptide methionine sulfoxide reductase MsrA OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=msrA PE=3 SV=1 16 174 5.0E-30
sp|A9MCZ5|MSRA_BRUC2 Peptide methionine sulfoxide reductase MsrA OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=msrA PE=3 SV=1 16 174 5.0E-30
sp|Q576P8|MSRA_BRUAB Peptide methionine sulfoxide reductase MsrA OS=Brucella abortus biovar 1 (strain 9-941) GN=msrA PE=3 SV=1 16 174 5.0E-30
sp|Q2YJM1|MSRA_BRUA2 Peptide methionine sulfoxide reductase MsrA OS=Brucella abortus (strain 2308) GN=msrA PE=3 SV=1 16 174 5.0E-30
sp|B2SC53|MSRA_BRUA1 Peptide methionine sulfoxide reductase MsrA OS=Brucella abortus (strain S19) GN=msrA PE=3 SV=1 16 174 5.0E-30
sp|Q48UX4|MSRA_STRPM Peptide methionine sulfoxide reductase MsrA OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=msrA PE=3 SV=1 22 184 6.0E-30
sp|Q9AL99|MSRAB_AGGAC Peptide methionine sulfoxide reductase MsrA/MsrB OS=Aggregatibacter actinomycetemcomitans GN=msrAB PE=3 SV=1 26 189 6.0E-30
sp|Q1WU33|MSRA_LACS1 Peptide methionine sulfoxide reductase MsrA OS=Lactobacillus salivarius (strain UCC118) GN=msrA PE=3 SV=1 26 174 1.0E-29
sp|Q1JI75|MSRA_STRPD Peptide methionine sulfoxide reductase MsrA OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=msrA PE=3 SV=1 22 184 1.0E-29
sp|Q9A149|MSRA_STRP1 Peptide methionine sulfoxide reductase MsrA OS=Streptococcus pyogenes serotype M1 GN=msrA PE=3 SV=1 22 184 2.0E-29
sp|B5XK66|MSRA_STRPZ Peptide methionine sulfoxide reductase MsrA OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=msrA PE=3 SV=1 22 184 2.0E-29
sp|Q1JD56|MSRA_STRPB Peptide methionine sulfoxide reductase MsrA OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=msrA PE=3 SV=1 22 184 2.0E-29
sp|Q1JN29|MSRA_STRPC Peptide methionine sulfoxide reductase MsrA OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=msrA PE=3 SV=1 22 184 2.0E-29
sp|Q8Y640|MSRA_LISMO Peptide methionine sulfoxide reductase MsrA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=msrA PE=3 SV=1 19 175 3.0E-29
sp|B8DDP2|MSRA_LISMH Peptide methionine sulfoxide reductase MsrA OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=msrA PE=3 SV=1 19 175 3.0E-29
sp|Q9CE42|MSRA2_LACLA Peptide methionine sulfoxide reductase MsrA 2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=msrA2 PE=3 SV=1 20 184 3.0E-29
sp|B9DRF3|MSRA_STRU0 Peptide methionine sulfoxide reductase MsrA OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=msrA PE=3 SV=1 22 184 3.0E-29
sp|Q65ID1|MSRA_BACLD Peptide methionine sulfoxide reductase MsrA OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=msrA PE=3 SV=1 17 174 3.0E-29
sp|Q71YF6|MSRA_LISMF Peptide methionine sulfoxide reductase MsrA OS=Listeria monocytogenes serotype 4b (strain F2365) GN=msrA PE=3 SV=1 19 175 3.0E-29
sp|C1KWF9|MSRA_LISMC Peptide methionine sulfoxide reductase MsrA OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=msrA PE=3 SV=1 19 175 3.0E-29
sp|B5ZB99|MSRA_UREU1 Peptide methionine sulfoxide reductase MsrA OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=msrA PE=3 SV=1 26 174 4.0E-29
sp|Q88AI5|MSRA_PSESM Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=msrA PE=3 SV=1 16 174 6.0E-29
sp|A5WC53|MSRA_PSYWF Peptide methionine sulfoxide reductase MsrA OS=Psychrobacter sp. (strain PRwf-1) GN=msrA PE=3 SV=1 22 180 6.0E-29
sp|A1R7D2|MSRA_ARTAT Peptide methionine sulfoxide reductase MsrA OS=Arthrobacter aurescens (strain TC1) GN=msrA PE=3 SV=1 25 171 6.0E-29
sp|P0A085|MSRA2_STAAW Peptide methionine sulfoxide reductase MsrA 2 OS=Staphylococcus aureus (strain MW2) GN=msrA2 PE=3 SV=1 25 174 7.0E-29
sp|Q6G9D7|MSRA2_STAAS Peptide methionine sulfoxide reductase MsrA 2 OS=Staphylococcus aureus (strain MSSA476) GN=msrA2 PE=3 SV=1 25 174 7.0E-29
sp|P0A086|MSRA2_STAA8 Peptide methionine sulfoxide reductase MsrA 2 OS=Staphylococcus aureus (strain NCTC 8325) GN=msrA2 PE=1 SV=1 25 174 7.0E-29
sp|P65446|MSRA2_STAAN Peptide methionine sulfoxide reductase MsrA 2 OS=Staphylococcus aureus (strain N315) GN=msrA2 PE=1 SV=1 25 174 7.0E-29
sp|P65445|MSRA2_STAAM Peptide methionine sulfoxide reductase MsrA 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=msrA2 PE=3 SV=1 25 174 7.0E-29
sp|O25011|MSRAB_HELPY Peptide methionine sulfoxide reductase MsrA/MsrB OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=msrAB PE=3 SV=1 26 174 8.0E-29
sp|B8IJD1|MSRA_METNO Peptide methionine sulfoxide reductase MsrA OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=msrA PE=3 SV=1 16 174 9.0E-29
sp|P54154|MSRA_BACSU Peptide methionine sulfoxide reductase MsrA OS=Bacillus subtilis (strain 168) GN=msrA PE=1 SV=1 17 175 1.0E-28
sp|Q9PC45|MSRA_XYLFA Peptide methionine sulfoxide reductase MsrA OS=Xylella fastidiosa (strain 9a5c) GN=msrA PE=3 SV=1 20 174 2.0E-28
sp|Q6GGY3|MSRA2_STAAR Peptide methionine sulfoxide reductase MsrA 2 OS=Staphylococcus aureus (strain MRSA252) GN=msrA2 PE=3 SV=1 25 174 2.0E-28
sp|A9KPX7|MSRA_CLOPH Peptide methionine sulfoxide reductase MsrA OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=msrA PE=3 SV=1 26 174 2.0E-28
sp|B0U2B7|MSRA_XYLFM Peptide methionine sulfoxide reductase MsrA OS=Xylella fastidiosa (strain M12) GN=msrA PE=3 SV=1 20 174 2.0E-28
sp|P47648|MSRA_MYCGE Peptide methionine sulfoxide reductase MsrA OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=msrA PE=1 SV=1 26 174 2.0E-28
sp|Q92AE8|MSRA_LISIN Peptide methionine sulfoxide reductase MsrA OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=msrA PE=3 SV=1 19 175 2.0E-28
sp|B4U465|MSRA_STREM Peptide methionine sulfoxide reductase MsrA OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=msrA PE=3 SV=1 22 184 3.0E-28
sp|Q9PQK2|MSRA_UREPA Peptide methionine sulfoxide reductase MsrA OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=msrA PE=3 SV=1 26 174 3.0E-28
sp|B1AIS8|MSRA_UREP2 Peptide methionine sulfoxide reductase MsrA OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=msrA PE=3 SV=1 26 174 3.0E-28
sp|Q8E434|MSRA_STRA3 Peptide methionine sulfoxide reductase MsrA OS=Streptococcus agalactiae serotype III (strain NEM316) GN=msrA PE=3 SV=1 22 178 3.0E-28
sp|C0MBS9|MSRA_STRE4 Peptide methionine sulfoxide reductase MsrA OS=Streptococcus equi subsp. equi (strain 4047) GN=msrA PE=3 SV=1 22 184 3.0E-28
sp|C0MCD1|MSRA_STRS7 Peptide methionine sulfoxide reductase MsrA OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=msrA PE=3 SV=1 22 184 3.0E-28
sp|Q87D27|MSRA_XYLFT Peptide methionine sulfoxide reductase MsrA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=msrA PE=3 SV=1 20 174 4.0E-28
sp|B2I4P8|MSRA_XYLF2 Peptide methionine sulfoxide reductase MsrA OS=Xylella fastidiosa (strain M23) GN=msrA PE=3 SV=1 20 174 4.0E-28
sp|Q8DYH1|MSRA_STRA5 Peptide methionine sulfoxide reductase MsrA OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=msrA PE=3 SV=1 22 178 4.0E-28
sp|Q3K013|MSRA_STRA1 Peptide methionine sulfoxide reductase MsrA OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=msrA PE=3 SV=1 22 178 4.0E-28
sp|Q02EZ9|MSRA_PSEAB Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=msrA PE=3 SV=1 16 174 5.0E-28
sp|Q9HUF1|MSRA_PSEAE Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msrA PE=3 SV=1 16 174 5.0E-28
sp|B7V3B1|MSRA_PSEA8 Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas aeruginosa (strain LESB58) GN=msrA PE=3 SV=1 16 174 5.0E-28
sp|A0JXQ4|MSRA_ARTS2 Peptide methionine sulfoxide reductase MsrA OS=Arthrobacter sp. (strain FB24) GN=msrA PE=3 SV=1 25 171 7.0E-28
sp|P75188|MSRA_MYCPN Peptide methionine sulfoxide reductase MsrA OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=msrA PE=3 SV=1 21 174 7.0E-28
sp|P45213|MSRAB_HAEIN Peptide methionine sulfoxide reductase MsrA/MsrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=msrAB PE=1 SV=1 26 189 2.0E-27
sp|A0AJW5|MSRA_LISW6 Peptide methionine sulfoxide reductase MsrA OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=msrA PE=3 SV=1 19 175 2.0E-27
sp|Q03W54|MSRA_LEUMM Peptide methionine sulfoxide reductase MsrA OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=msrA PE=3 SV=1 22 171 2.0E-27
sp|A7Z5S2|MSRA_BACMF Peptide methionine sulfoxide reductase MsrA OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=msrA PE=3 SV=1 17 174 2.0E-27
sp|Q9LAM9|MSRAB_STRGC Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=msrAB PE=3 SV=1 26 187 3.0E-27
sp|A8FEA4|MSRA_BACP2 Peptide methionine sulfoxide reductase MsrA OS=Bacillus pumilus (strain SAFR-032) GN=msrA PE=3 SV=1 17 175 4.0E-27
sp|Q93KF3|MSRAB_CAMFE Peptide methionine sulfoxide reductase MsrA/MsrB OS=Campylobacter fetus GN=msrAB PE=3 SV=1 26 174 5.0E-27
sp|P86890|MSRAB_ENTFL Peptide methionine sulfoxide reductase msrA/msrB OS=Enterococcus faecalis GN=msrAB PE=1 SV=1 26 174 5.0E-27
sp|Q9CFC8|MSRA1_LACLA Peptide methionine sulfoxide reductase MsrA 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=msrA1 PE=3 SV=1 22 176 7.0E-27
sp|Q9KAN8|MSRA_BACHD Peptide methionine sulfoxide reductase MsrA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=msrA PE=3 SV=1 22 175 1.0E-26
sp|Q8DSY4|MSRA_STRMU Peptide methionine sulfoxide reductase MsrA OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=msrA PE=3 SV=1 22 184 2.0E-26
sp|Q5HG58|MSRA_STAAC Peptide methionine sulfoxide reductase MsrA OS=Staphylococcus aureus (strain COL) GN=msrA PE=3 SV=1 26 185 3.0E-26
sp|P0A083|MSRA1_STAAW Peptide methionine sulfoxide reductase MsrA 1 OS=Staphylococcus aureus (strain MW2) GN=msrA1 PE=3 SV=1 26 185 3.0E-26
sp|Q6G9J8|MSRA1_STAAS Peptide methionine sulfoxide reductase MsrA 1 OS=Staphylococcus aureus (strain MSSA476) GN=msrA1 PE=3 SV=1 26 185 3.0E-26
sp|Q6GH44|MSRA1_STAAR Peptide methionine sulfoxide reductase MsrA 1 OS=Staphylococcus aureus (strain MRSA252) GN=msrA1 PE=3 SV=1 26 185 3.0E-26
sp|P0A082|MSRA1_STAAN Peptide methionine sulfoxide reductase MsrA 1 OS=Staphylococcus aureus (strain N315) GN=msrA1 PE=1 SV=1 26 185 3.0E-26
sp|P0A081|MSRA1_STAAM Peptide methionine sulfoxide reductase MsrA 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=msrA1 PE=1 SV=1 26 185 3.0E-26
sp|P0A084|MSRA1_STAA8 Peptide methionine sulfoxide reductase MsrA 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=msrA1 PE=3 SV=1 26 185 3.0E-26
sp|P0DC41|MSRAB_STRPQ Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=msrAB PE=3 SV=1 26 174 3.0E-26
sp|P0DC40|MSRAB_STRP3 Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=msrAB PE=3 SV=1 26 174 3.0E-26
sp|Q9AJF7|MSRA_THEVU Peptide methionine sulfoxide reductase MsrA OS=Thermoactinomyces vulgaris GN=msrA PE=3 SV=1 25 127 3.0E-26
sp|Q3BX45|MSRA_XANC5 Peptide methionine sulfoxide reductase MsrA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=msrA PE=3 SV=1 20 174 3.0E-26
sp|B2SQI9|MSRA_XANOP Peptide methionine sulfoxide reductase MsrA OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=msrA PE=3 SV=1 20 174 7.0E-26
sp|Q2NZR7|MSRA_XANOM Peptide methionine sulfoxide reductase MsrA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=msrA PE=3 SV=1 20 174 8.0E-26
sp|Q8P046|MSRAB_STRP8 Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=msrAB PE=3 SV=2 26 174 1.0E-25
sp|Q5XAX5|MSRAB_STRP6 Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=msrAB PE=3 SV=2 26 174 1.0E-25
sp|Q99YT1|MSRAB_STRP1 Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus pyogenes serotype M1 GN=msrAB PE=3 SV=2 26 174 1.0E-25
sp|Q4UR77|MSRA_XANC8 Peptide methionine sulfoxide reductase MsrA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=msrA PE=3 SV=1 20 174 1.0E-25
sp|Q8PCA6|MSRA_XANCP Peptide methionine sulfoxide reductase MsrA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=msrA PE=3 SV=1 20 174 2.0E-25
sp|B0RUE7|MSRA_XANCB Peptide methionine sulfoxide reductase MsrA OS=Xanthomonas campestris pv. campestris (strain B100) GN=msrA PE=3 SV=1 20 174 2.0E-25
sp|Q8VS50|MSRA_XANCH Peptide methionine sulfoxide reductase MsrA OS=Xanthomonas campestris pv. phaseoli GN=msrA PE=3 SV=1 20 174 2.0E-25
sp|Q38XB4|MSRA_LACSS Peptide methionine sulfoxide reductase MsrA OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=msrA PE=3 SV=1 20 171 3.0E-25
sp|Q7VI69|MSRA_HELHP Peptide methionine sulfoxide reductase MsrA OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=msrA PE=3 SV=1 26 185 6.0E-25
sp|A5VKT1|MSRA_LACRD Peptide methionine sulfoxide reductase MsrA OS=Lactobacillus reuteri (strain DSM 20016) GN=msrA PE=3 SV=1 26 171 8.0E-25
sp|P0A3R0|MSAB1_STRR6 Peptide methionine sulfoxide reductase MsrA/MsrB 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=msrAB1 PE=1 SV=1 26 187 9.0E-25
sp|P0A3Q9|MSAB1_STRPN Peptide methionine sulfoxide reductase MsrA/MsrB 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=msrAB1 PE=1 SV=1 26 187 9.0E-25
sp|Q8PNY8|MSRA_XANAC Peptide methionine sulfoxide reductase MsrA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=msrA PE=3 SV=1 20 174 1.0E-24
sp|Q9A9E9|MSRA2_CAUCR Peptide methionine sulfoxide reductase MsrA 2 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=msrA2 PE=3 SV=1 22 174 2.0E-24
sp|B3PND9|MSRA_MYCA5 Peptide methionine sulfoxide reductase MsrA OS=Mycoplasma arthritidis (strain 158L3-1) GN=msrA PE=3 SV=1 22 173 2.0E-22
sp|P65444|MSAB2_STRR6 Peptide methionine sulfoxide reductase MsrA/MsrB 2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=msrAB2 PE=3 SV=1 26 174 2.0E-22
sp|P65443|MSAB2_STRPN Peptide methionine sulfoxide reductase MsrA/MsrB 2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=msrAB2 PE=3 SV=1 26 174 2.0E-22
sp|Q5VPG8|MSRA5_ORYSJ Peptide methionine sulfoxide reductase A5 OS=Oryza sativa subsp. japonica GN=MSRA5 PE=2 SV=1 26 171 8.0E-20
sp|Q9SL43|MSRA5_ARATH Peptide methionine sulfoxide reductase A5 OS=Arabidopsis thaliana GN=MSRA5 PE=2 SV=1 13 183 5.0E-19
sp|Q98PE5|MSRA_MYCPU Peptide methionine sulfoxide reductase MsrA OS=Mycoplasma pulmonis (strain UAB CTIP) GN=msrA PE=3 SV=2 26 186 2.0E-18
sp|P08761|MSRA_DROME Peptide methionine sulfoxide reductase OS=Drosophila melanogaster GN=Eip71CD PE=2 SV=2 24 166 2.0E-18
sp|Q92LI5|MSRA2_RHIME Peptide methionine sulfoxide reductase MsrA 2 OS=Rhizobium meliloti (strain 1021) GN=msrA2 PE=3 SV=1 22 171 1.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0008113 peptide-methionine (S)-S-oxide reductase activity Yes
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0003674 molecular_function No
GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup667
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1456
Ophiocordyceps australis map64 (Brazil) OphauB2|7872
Ophiocordyceps camponoti-floridani Ophcf2|01049
Ophiocordyceps camponoti-rufipedis Ophun1|3860 (this protein)
Ophiocordyceps kimflemingae Ophio5|6814
Ophiocordyceps subramaniannii Hirsu2|10863

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3860
MPASTTAAPASDPDPPLPEGAQRCTLAAGCFWGVEHLYRRHFGEALVGLRVGYTGGALDKPSYRAVCGGDTGHAE
ATQIDFDPQKVSYRQLLEFFFRIHDPTTPNRQGPDTGSQYRSAIFYHSPEQETTARRVAALASDTWWRGAIVTQI
LPAGRWWSAEEYHQLYLQRNPGGYECPSHIVRDFPPLPE*
Coding >Ophun1|3860
ATGCCAGCCTCCACCACCGCCGCCCCCGCCTCCGACCCGGACCCTCCCCTCCCCGAAGGCGCCCAGCGCTGCACC
CTCGCCGCCGGCTGCTTCTGGGGCGTCGAGCATCTCTACCGCCGGCACTTTGGCGAGGCCCTCGTCGGTCTCCGC
GTTGGATACACGGGCGGTGCGCTGGACAAGCCCTCGTATCGGGCCGTCTGTGGCGGCGACACGGGCCACGCCGAG
GCCACGCAAATCGACTTCGACCCTCAAAAAGTCTCGTACCGCCAGCTCCTCGAATTCTTCTTCCGCATCCACGAC
CCCACAACCCCCAACCGCCAAGGCCCAGACACGGGATCCCAGTACCGCTCCGCCATCTTCTACCACTCTCCCGAG
CAGGAGACGACGGCCCGCCGCGTGGCCGCCCTCGCCTCCGACACCTGGTGGCGCGGCGCCATCGTCACCCAGATA
CTGCCCGCCGGTCGCTGGTGGTCGGCCGAGGAGTACCATCAGCTCTATCTGCAGCGTAACCCCGGCGGCTATGAG
TGCCCGAGCCATATCGTTCGCGACTTTCCGCCGCTGCCGGAATGA
Transcript >Ophun1|3860
ATGCCAGCCTCCACCACCGCCGCCCCCGCCTCCGACCCGGACCCTCCCCTCCCCGAAGGCGCCCAGCGCTGCACC
CTCGCCGCCGGCTGCTTCTGGGGCGTCGAGCATCTCTACCGCCGGCACTTTGGCGAGGCCCTCGTCGGTCTCCGC
GTTGGATACACGGGCGGTGCGCTGGACAAGCCCTCGTATCGGGCCGTCTGTGGCGGCGACACGGGCCACGCCGAG
GCCACGCAAATCGACTTCGACCCTCAAAAAGTCTCGTACCGCCAGCTCCTCGAATTCTTCTTCCGCATCCACGAC
CCCACAACCCCCAACCGCCAAGGCCCAGACACGGGATCCCAGTACCGCTCCGCCATCTTCTACCACTCTCCCGAG
CAGGAGACGACGGCCCGCCGCGTGGCCGCCCTCGCCTCCGACACCTGGTGGCGCGGCGCCATCGTCACCCAGATA
CTGCCCGCCGGTCGCTGGTGGTCGGCCGAGGAGTACCATCAGCTCTATCTGCAGCGTAACCCCGGCGGCTATGAG
TGCCCGAGCCATATCGTTCGCGACTTTCCGCCGCTGCCGGAATGA
Gene >Ophun1|3860
ATGCCAGCCTCCACCACCGCCGCCCCCGCCTCCGACCCGGACCCTCCCCTCCCCGAAGGCGCCCAGCGCTGCACC
CTCGCCGCCGGCTGCTTCTGGGGCGTCGAGCATCTCTACCGCCGGCACTTTGGCGAGGCCCTCGTCGGTCTCCGC
GTTGGATACACGGGCGGTGCGCTGGACAAGCCCTCGTATCGGGCCGTCTGTGGCGGCGACACGGGCCGTACGTCG
TTGCCCCCTTTTCATCTCCCCTCTCCACCACACCACTGATGGAAAGAATCCCTGATGAATCCTCACGAGAAAAAT
CATGACAGACGCCGAGGCCACGCAAATCGACTTCGACCCTCAAAAAGTCTCGTACCGCCAGCTCCTCGAATTCTT
CTTCCGCATCCACGACCCCACAACCCCCAACCGCCAAGGCCCAGACACGGGATCCCAGTACCGCTCCGCCATCTT
CTACCACTCTCCCGAGCAGGAGACGACGGCCCGCCGCGTGGCCGCCCTCGCCTCCGACACCTGGTGGCGCGGCGC
CATCGTCACCCAGATACTGCCCGCCGGTCGCTGGTGGTCGGCCGAGGAGTACCATCAGCTCTATCTGCAGCGTAA
CCCCGGCGGCTATGAGTGCCCGAGCCATATCGTTCGCGACTTTCCGCCGCTGCCGGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail