Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|386
Gene name
LocationContig_110:27034..28381
Strand-
Gene length (bp)1347
Transcript length (bp)1149
Coding sequence length (bp)1149
Protein length (aa) 383

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal 3.5E-17 59 165
PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily 7.0E-17 208 329

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Z3T0|EFE_PSESJ 2-oxoglutarate-dependent ethylene/succinate-forming enzyme OS=Pseudomonas syringae pv. pisi GN=efe PE=3 SV=1 45 374 4.0E-117
sp|P32021|EFE_PSESH 2-oxoglutarate-dependent ethylene/succinate-forming enzyme OS=Pseudomonas savastanoi pv. phaseolicola GN=efe PE=1 SV=1 45 374 2.0E-116
sp|Q7BS31|EFE_PSECA 2-oxoglutarate-dependent ethylene/succinate-forming enzyme OS=Pseudomonas cannabina GN=efe PE=3 SV=1 45 374 2.0E-115
sp|Q9Z377|EFE_PSEAQ 2-oxoglutarate-dependent ethylene/succinate-forming enzyme OS=Pseudomonas amygdali pv. sesami GN=efe PE=3 SV=1 45 374 2.0E-115
sp|Q7BS32|EFE_PSESG 2-oxoglutarate-dependent ethylene/succinate-forming enzyme OS=Pseudomonas savastanoi pv. glycinea GN=efe PE=1 SV=1 45 374 2.0E-115
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Z3T0|EFE_PSESJ 2-oxoglutarate-dependent ethylene/succinate-forming enzyme OS=Pseudomonas syringae pv. pisi GN=efe PE=3 SV=1 45 374 4.0E-117
sp|P32021|EFE_PSESH 2-oxoglutarate-dependent ethylene/succinate-forming enzyme OS=Pseudomonas savastanoi pv. phaseolicola GN=efe PE=1 SV=1 45 374 2.0E-116
sp|Q7BS31|EFE_PSECA 2-oxoglutarate-dependent ethylene/succinate-forming enzyme OS=Pseudomonas cannabina GN=efe PE=3 SV=1 45 374 2.0E-115
sp|Q9Z377|EFE_PSEAQ 2-oxoglutarate-dependent ethylene/succinate-forming enzyme OS=Pseudomonas amygdali pv. sesami GN=efe PE=3 SV=1 45 374 2.0E-115
sp|Q7BS32|EFE_PSESG 2-oxoglutarate-dependent ethylene/succinate-forming enzyme OS=Pseudomonas savastanoi pv. glycinea GN=efe PE=1 SV=1 45 374 2.0E-115
sp|Q8XPV7|EFE_RALSO 2-oxoglutarate-dependent ethylene/succinate-forming enzyme OS=Ralstonia solanacearum (strain GMI1000) GN=efe PE=3 SV=1 45 378 3.0E-112
sp|Q54RA4|Y3291_DICDI Probable iron/ascorbate oxidoreductase DDB_G0283291 OS=Dictyostelium discoideum GN=DDB_G0283291 PE=3 SV=1 61 358 3.0E-26
sp|Q84MB6|DIOX2_ARATH Probable 2-oxoglutarate-dependent dioxygenase At3g49630 OS=Arabidopsis thaliana GN=At3g50210 PE=2 SV=1 63 365 5.0E-24
sp|A6BM06|ACCO1_DICMU 1-aminocyclopropane-1-carboxylate oxidase OS=Dictyostelium mucoroides GN=aco PE=3 SV=1 39 372 5.0E-20
sp|Q76NT9|ACCO1_DICDI 1-aminocyclopropane-1-carboxylate oxidase OS=Dictyostelium discoideum GN=aco PE=2 SV=1 39 372 5.0E-20
sp|F4IY03|DIOX1_ARATH Probable 2-oxoglutarate-dependent dioxygenase At3g49630 OS=Arabidopsis thaliana GN=At3g49630 PE=3 SV=1 70 359 7.0E-16
sp|Q8H113|DIN11_ARATH Probable 2-oxoglutarate-dependent dioxygenase DIN11 OS=Arabidopsis thaliana GN=DIN11 PE=2 SV=1 70 369 8.0E-16
sp|Q05963|FL3H_CALCH Naringenin,2-oxoglutarate 3-dioxygenase OS=Callistephus chinensis GN=FHT PE=2 SV=1 63 349 4.0E-14
sp|Q9C899|F6H2_ARATH Feruloyl CoA ortho-hydroxylase 2 OS=Arabidopsis thaliana GN=F6'H2 PE=1 SV=1 49 348 2.0E-13
sp|Q05965|FL3H_MATIN Naringenin,2-oxoglutarate 3-dioxygenase (Fragment) OS=Matthiola incana GN=FHT PE=2 SV=1 63 349 3.0E-13
sp|P40902|ISP7_SCHPO Sexual differentiation process protein isp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp7 PE=2 SV=1 117 340 4.0E-13
sp|Q7XZQ8|FNSI_PETCR Flavone synthase OS=Petroselinum crispum GN=FNSI PE=1 SV=1 63 381 1.0E-12
sp|Q7XZQ7|FL3H_PETCR Flavanone 3-dioxygenase OS=Petroselinum crispum GN=FHT PE=1 SV=1 63 349 2.0E-12
sp|D4N502|DIOX3_PAPSO Codeine O-demethylase OS=Papaver somniferum GN=CODM PE=1 SV=1 19 347 3.0E-12
sp|Q07353|FL3H_PETHY Naringenin,2-oxoglutarate 3-dioxygenase (Fragment) OS=Petunia hybrida GN=AN3 PE=1 SV=1 67 382 4.0E-12
sp|Q39110|GAOX1_ARATH Gibberellin 20 oxidase 1 OS=Arabidopsis thaliana GN=GA20OX1 PE=2 SV=2 14 337 4.0E-12
sp|Q9S818|FL3H_ARATH Naringenin,2-oxoglutarate 3-dioxygenase OS=Arabidopsis thaliana GN=F3H PE=1 SV=1 63 349 5.0E-12
sp|A2A1A0|NCS1_COPJA S-norcoclaurine synthase 1 OS=Coptis japonica GN=NCS1 PE=1 SV=1 47 338 8.0E-12
sp|Q9LHN8|F6H1_ARATH Feruloyl CoA ortho-hydroxylase 1 OS=Arabidopsis thaliana GN=F6'H1 PE=1 SV=1 50 348 9.0E-12
sp|P41090|FL3H_VITVI Naringenin,2-oxoglutarate 3-dioxygenase OS=Vitis vinifera GN=F3H PE=2 SV=1 63 382 1.0E-11
sp|D4N500|DIOX1_PAPSO Thebaine 6-O-demethylase OS=Papaver somniferum GN=T6ODM PE=1 SV=1 70 354 6.0E-11
sp|Q9C971|G3OX4_ARATH Gibberellin 3-beta-dioxygenase 4 OS=Arabidopsis thaliana GN=GA3OX4 PE=1 SV=1 75 347 2.0E-10
sp|A2Z1W9|ACCO1_ORYSI 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Oryza sativa subsp. indica GN=ACO1 PE=2 SV=1 161 351 4.0E-10
sp|Q9C6I4|G2OX7_ARATH Gibberellin 2-beta-dioxygenase 7 OS=Arabidopsis thaliana GN=GA2OX7 PE=1 SV=1 58 329 5.0E-10
sp|D4N501|DIOX2_PAPSO Probable 2-oxoglutarate/Fe(II)-dependent dioxygenase OS=Papaver somniferum GN=DIOX2 PE=2 SV=1 58 354 6.0E-10
sp|Q0J1C1|ACCO1_ORYSJ 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Oryza sativa subsp. japonica GN=ACO1 PE=2 SV=1 161 351 7.0E-10
sp|Q944Z5|AOP1V_ARATH Probable 2-oxoglutarate-dependent dioxygenase AOP1 (Fragment) OS=Arabidopsis thaliana GN=AOP1 PE=2 SV=1 56 335 3.0E-09
sp|Q08508|ACCO4_PETHY 1-aminocyclopropane-1-carboxylate oxidase 4 OS=Petunia hybrida GN=ACO4 PE=3 SV=1 108 337 6.0E-09
sp|Q9ZTA3|AOP1C_ARATH Probable 2-oxoglutarate-dependent dioxygenase AOP1 OS=Arabidopsis thaliana GN=AOP1 PE=2 SV=1 56 335 9.0E-09
sp|P93771|GAOX1_ORYSJ Gibberellin 20 oxidase 1 OS=Oryza sativa subsp. japonica GN=20ox1 PE=2 SV=2 36 337 2.0E-08
sp|Q0JH50|GAOX2_ORYSJ Gibberellin 20 oxidase 2 OS=Oryza sativa subsp. japonica GN=20ox2 PE=1 SV=1 170 337 3.0E-08
sp|Q9XG83|G2OX_PHACN Gibberellin 2-beta-dioxygenase OS=Phaseolus coccineus GN=GA2OX1 PE=2 SV=1 167 338 3.0E-08
sp|P0C5H5|GAOX2_ORYSI Gibberellin 20 oxidase 2 OS=Oryza sativa subsp. indica GN=20ox2 PE=1 SV=1 170 337 3.0E-08
sp|Q39103|G3OX1_ARATH Gibberellin 3-beta-dioxygenase 1 OS=Arabidopsis thaliana GN=GA3OX1 PE=1 SV=2 70 338 4.0E-08
sp|O24648|G3OX_PEA Gibberellin 3-beta-dioxygenase 1 OS=Pisum sativum GN=LE PE=1 SV=1 231 347 7.0E-08
sp|O64692|G2OX3_ARATH Gibberellin 2-beta-dioxygenase 3 OS=Arabidopsis thaliana GN=GA2OX3 PE=2 SV=1 167 346 1.0E-07
sp|Q39112|GAOX3_ARATH Gibberellin 20 oxidase 3 OS=Arabidopsis thaliana GN=GA20OX3 PE=2 SV=1 70 367 1.0E-07
sp|Q8LEA2|G2OX1_ARATH Gibberellin 2-beta-dioxygenase 1 OS=Arabidopsis thaliana GN=GA2OX1 PE=2 SV=2 167 374 1.0E-07
sp|Q945B6|AOP1L_ARATH Probable 2-oxoglutarate-dependent dioxygenase AOP1.2 OS=Arabidopsis thaliana GN=AOP1.2 PE=2 SV=1 56 335 2.0E-07
sp|Q9SVS8|G3OX3_ARATH Gibberellin 3-beta-dioxygenase 3 OS=Arabidopsis thaliana GN=GA3OX3 PE=2 SV=1 50 340 2.0E-07
sp|O04395|FLS_MATIN Flavonol synthase/flavanone 3-hydroxylase (Fragment) OS=Matthiola incana PE=2 SV=1 50 347 7.0E-07
sp|Q9ZT84|G3OX2_ARATH Gibberellin 3-beta-dioxygenase 2 OS=Arabidopsis thaliana GN=GA3OX2 PE=1 SV=2 75 338 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|386
MANLARRVAVADKFIPGMMNGLGAHVQTVKAPNMPPGFKASVGKLETFTIPAEVTGSVSDKAMAKDMISAWRKDG
ILQIGMTHLQQRLFQDALSHSKRFFRRPLVEKRACVDSRSYSGYIASGEEVTDGVRDYSEIFTVTKDLPLSDQRV
MESWPCHGPCPWPDNGFKEVISRYIAELGGCGQRLLQLIELGLGVQAGSLTRYTTDGWHHMRVLRFPARHLTNGK
GKSGRGIGSHTDYGLLVIGSQDHIGGLFVRPPKEGENFVNWEQSAAGAKENDDGWMYVPPEQGTLTVFPGDIMQY
LTNHVLRSTPHKVGLNTAERFALAYFHEPDFGSVVRPLAGYNGGQEPVEGFSYGTHFTNMCLRNYPDRITTRRLL
ERGHWQQ*
Coding >Ophun1|386
ATGGCGAACCTTGCCAGGCGCGTCGCGGTGGCCGACAAGTTCATCCCGGGCATGATGAATGGGCTCGGGGCCCAC
GTCCAGACCGTCAAGGCGCCGAATATGCCTCCTGGCTTCAAGGCCTCAGTCGGGAAGCTCGAGACATTCACCATC
CCCGCCGAGGTGACGGGGTCCGTCTCGGACAAGGCCATGGCCAAAGACATGATCAGCGCCTGGCGCAAGGACGGC
ATTCTGCAGATCGGCATGACCCATCTCCAGCAGCGGCTGTTTCAGGACGCCCTCTCTCACAGCAAGCGGTTCTTC
CGTCGTCCACTCGTAGAGAAGCGGGCTTGCGTCGACAGTCGTAGCTACAGCGGATACATCGCTTCCGGAGAAGAG
GTCACCGACGGCGTCAGGGACTACTCGGAGATCTTTACCGTGACCAAGGATCTCCCCCTCAGTGACCAAAGGGTG
ATGGAGAGCTGGCCGTGTCACGGACCGTGTCCCTGGCCAGACAACGGCTTCAAGGAGGTCATCAGCCGCTACATA
GCTGAGCTTGGAGGTTGTGGGCAGCGACTCCTCCAGCTTATCGAGCTGGGACTGGGCGTGCAAGCCGGATCTTTG
ACGAGATACACTACCGACGGATGGCACCACATGCGGGTGCTCAGATTTCCGGCCCGGCACTTGACCAATGGCAAG
GGCAAAAGCGGCCGCGGAATCGGCTCTCACACGGATTACGGGCTGTTGGTTATTGGCTCCCAGGATCACATTGGC
GGTCTCTTCGTTCGGCCTCCAAAGGAAGGCGAGAACTTCGTCAACTGGGAGCAAAGTGCTGCCGGAGCCAAGGAG
AACGACGATGGATGGATGTATGTCCCGCCAGAGCAGGGCACCCTTACCGTCTTCCCAGGAGACATCATGCAATAC
CTGACGAACCATGTGCTGCGGTCGACGCCGCACAAGGTCGGGTTAAACACGGCCGAGCGGTTTGCCTTGGCTTAC
TTCCACGAGCCTGATTTTGGGTCTGTTGTTAGGCCGCTTGCTGGGTATAATGGTGGCCAGGAGCCTGTTGAGGGC
TTCAGCTATGGAACGCACTTTACGAATATGTGTCTGCGGAACTATCCTGACCGTATTACTACGAGGAGGTTGCTG
GAGAGGGGGCATTGGCAACAATAG
Transcript >Ophun1|386
ATGGCGAACCTTGCCAGGCGCGTCGCGGTGGCCGACAAGTTCATCCCGGGCATGATGAATGGGCTCGGGGCCCAC
GTCCAGACCGTCAAGGCGCCGAATATGCCTCCTGGCTTCAAGGCCTCAGTCGGGAAGCTCGAGACATTCACCATC
CCCGCCGAGGTGACGGGGTCCGTCTCGGACAAGGCCATGGCCAAAGACATGATCAGCGCCTGGCGCAAGGACGGC
ATTCTGCAGATCGGCATGACCCATCTCCAGCAGCGGCTGTTTCAGGACGCCCTCTCTCACAGCAAGCGGTTCTTC
CGTCGTCCACTCGTAGAGAAGCGGGCTTGCGTCGACAGTCGTAGCTACAGCGGATACATCGCTTCCGGAGAAGAG
GTCACCGACGGCGTCAGGGACTACTCGGAGATCTTTACCGTGACCAAGGATCTCCCCCTCAGTGACCAAAGGGTG
ATGGAGAGCTGGCCGTGTCACGGACCGTGTCCCTGGCCAGACAACGGCTTCAAGGAGGTCATCAGCCGCTACATA
GCTGAGCTTGGAGGTTGTGGGCAGCGACTCCTCCAGCTTATCGAGCTGGGACTGGGCGTGCAAGCCGGATCTTTG
ACGAGATACACTACCGACGGATGGCACCACATGCGGGTGCTCAGATTTCCGGCCCGGCACTTGACCAATGGCAAG
GGCAAAAGCGGCCGCGGAATCGGCTCTCACACGGATTACGGGCTGTTGGTTATTGGCTCCCAGGATCACATTGGC
GGTCTCTTCGTTCGGCCTCCAAAGGAAGGCGAGAACTTCGTCAACTGGGAGCAAAGTGCTGCCGGAGCCAAGGAG
AACGACGATGGATGGATGTATGTCCCGCCAGAGCAGGGCACCCTTACCGTCTTCCCAGGAGACATCATGCAATAC
CTGACGAACCATGTGCTGCGGTCGACGCCGCACAAGGTCGGGTTAAACACGGCCGAGCGGTTTGCCTTGGCTTAC
TTCCACGAGCCTGATTTTGGGTCTGTTGTTAGGCCGCTTGCTGGGTATAATGGTGGCCAGGAGCCTGTTGAGGGC
TTCAGCTATGGAACGCACTTTACGAATATGTGTCTGCGGAACTATCCTGACCGTATTACTACGAGGAGGTTGCTG
GAGAGGGGGCATTGGCAACAATAG
Gene >Ophun1|386
ATGGCGAACCTTGCCAGGCGCGTCGCGGTGGCCGACAAGTTCATCCCGGGCATGATGAATGGGCTCGGGGCCCAC
GTCCAGACCGTCAAGGCGCCGAATATGCCTCCTGGCTTCAAGGCCTCAGTCGGGAAGCTCGAGACATTCACCATC
CCCGCCGAGGTGACGGGGTCCGTCTCGGACAAGGCCATGGCCAAAGACATGATCAGCGCCTGGCGCAAGGACGGC
ATTCTGCAGATCGGCATGACCCATCTCCAGCAGCGGCTGTTTCAGGACGCCCTCTCTCACAGCAAGCGGTTCTTC
CGTCGTCCACTCGTAGAGAAGCGGGCTTGCGTCGACAGTCGTAGCTACAGCGGATACATCGCTTCCGGAGAAGAG
GTCACCGACGGCGTCAGGGACTACTCGGAGATCTTTACCGTGACCAAGGATCTCCCCCTCAGTGACCAAAGGGTG
ATGGAGAGCTGGCCGTGTCACGGACCGTGTCCCTGGCCAGACAACGGCTTCAAGGAGGTCATCAGCCGCTACATA
GCTGAGCTTGGAGGTTGTGGGCAGCGACTCCTCCAGCTTATCGAGCTGGGACTGGGCGTGCAAGCCGGATCTTTG
ACGAGATACACTACCGACGGATGGCACCACATGCGGGTGCTCAGGTGAGACTCCTACATACATCTACGAATGGGA
GGGTGACCAACAGAGGAGTTAACCTTGATCTTTTCATCAGATTTCCGGCCCGGCACTTGACCAATGGCAAGGGCA
AAAGCGGCCGCGGAATCGGCTCTCACACGGATTACGGGCTGTTGGTTATTGGCTCCCAGGATCACATTGGCGGTA
TGAATTGTCCGTTGCGTTGTGAAAATCGACGACTAACCGCGTGTCCCATCAGGTCTCTTCGTTCGGCCTCCAAAG
GAAGGCGAGAACTTCGTCAACTGGGAGCAAAGTGCTGCCGGAGCCAAGGAGAACGACGATGGATGGATGTATGTC
CCGCCAGAGCAGGGCACCCTTACCGTCTTCCCAGGTAGGCAAGGCCTCAACGCAGGGCGCGTGATGCCAAACGTG
GATACATGTAGCTGACGGCCCTGCCCTGCAGGAGACATCATGCAATACCTGACGAACCATGTGCTGCGGTCGACG
CCGCACAAGGTCGGGTTAAACACGGCCGAGCGGTTTGCCTTGGCTTACTTCCACGAGCCTGATTTTGGGTCTGTT
GTTAGGCCGCTTGCTGGGTATAATGGTGGCCAGGAGCCTGTTGAGGGCTTCAGCTATGGAACGCACTTTACGAAT
ATGTGTCTGCGGAACTATCCTGACCGTATTACTACGAGGAGGTTGCTGGAGAGGGGGCATTGGCAACAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail