Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3858
Gene name
LocationContig_348:13428..16635
Strand+
Gene length (bp)3207
Transcript length (bp)3207
Coding sequence length (bp)3207
Protein length (aa) 1069

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00027 cNMP_binding Cyclic nucleotide-binding domain 7.4E-19 97 172
PF00027 cNMP_binding Cyclic nucleotide-binding domain 1.4E-12 293 390
PF16643 cNMPbd_u2 Unstructured region on cNMP-binding protein 1.8E-22 395 540
PF00646 F-box F-box domain 1.0E-06 599 636
PF12937 F-box-like F-box-like 7.2E-06 600 634

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BJ29|FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus GN=Fbxl7 PE=1 SV=1 600 977 1.0E-25
sp|A1A5X2|FBXL7_DANRE F-box/LRR-repeat protein 7 OS=Danio rerio GN=fbxl7 PE=2 SV=1 600 977 1.0E-25
sp|Q9UJT9|FBXL7_HUMAN F-box/LRR-repeat protein 7 OS=Homo sapiens GN=FBXL7 PE=2 SV=1 600 977 4.0E-25
sp|P34284|YKK7_CAEEL Uncharacterized F-box/LRR-repeat protein C02F5.7 OS=Caenorhabditis elegans GN=C02F5.7 PE=3 SV=3 601 985 1.0E-20
sp|Q8N1E6|FXL14_HUMAN F-box/LRR-repeat protein 14 OS=Homo sapiens GN=FBXL14 PE=1 SV=1 666 977 7.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BJ29|FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus GN=Fbxl7 PE=1 SV=1 600 977 1.0E-25
sp|A1A5X2|FBXL7_DANRE F-box/LRR-repeat protein 7 OS=Danio rerio GN=fbxl7 PE=2 SV=1 600 977 1.0E-25
sp|Q9UJT9|FBXL7_HUMAN F-box/LRR-repeat protein 7 OS=Homo sapiens GN=FBXL7 PE=2 SV=1 600 977 4.0E-25
sp|P34284|YKK7_CAEEL Uncharacterized F-box/LRR-repeat protein C02F5.7 OS=Caenorhabditis elegans GN=C02F5.7 PE=3 SV=3 601 985 1.0E-20
sp|Q8N1E6|FXL14_HUMAN F-box/LRR-repeat protein 14 OS=Homo sapiens GN=FBXL14 PE=1 SV=1 666 977 7.0E-18
sp|Q8BID8|FXL14_MOUSE F-box/LRR-repeat protein 14 OS=Mus musculus GN=Fbxl14 PE=2 SV=1 666 977 1.0E-17
sp|Q17R01|FXL14_BOVIN F-box/LRR-repeat protein 14 OS=Bos taurus GN=FBXL14 PE=2 SV=1 666 977 1.0E-17
sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 601 980 5.0E-16
sp|Q58DG6|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2 601 980 5.0E-16
sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 601 980 6.0E-16
sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 601 978 1.0E-15
sp|Q9UL51|HCN2_HUMAN Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 OS=Homo sapiens GN=HCN2 PE=1 SV=3 13 202 2.0E-15
sp|Q5R3Z8|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1 601 960 2.0E-15
sp|Q9UKC9|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3 601 960 3.0E-15
sp|Q9JKA9|HCN2_RAT Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 OS=Rattus norvegicus GN=Hcn2 PE=1 SV=3 13 202 3.0E-15
sp|O88703|HCN2_MOUSE Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 OS=Mus musculus GN=Hcn2 PE=1 SV=1 13 202 3.0E-15
sp|A6H779|FBXL2_BOVIN F-box/LRR-repeat protein 2 OS=Bos taurus GN=FBXL2 PE=2 SV=1 601 960 4.0E-15
sp|P55934|CNG_ICTPU Cyclic nucleotide-gated cation channel OS=Ictalurus punctatus PE=2 SV=1 17 207 1.0E-14
sp|Q9QZH7|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1 810 980 6.0E-14
sp|A1A5X2|FBXL7_DANRE F-box/LRR-repeat protein 7 OS=Danio rerio GN=fbxl7 PE=2 SV=1 807 980 1.0E-13
sp|C8V4D4|GRRA_EMENI SCF E3 ubiquitin ligase complex F-box protein grrA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=grrA PE=2 SV=1 639 985 1.0E-13
sp|O60741|HCN1_HUMAN Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 OS=Homo sapiens GN=HCN1 PE=1 SV=3 14 202 1.0E-13
sp|Q90805|CNG1_CHICK Cyclic nucleotide-gated channel cone photoreceptor subunit alpha OS=Gallus gallus PE=2 SV=1 20 209 2.0E-13
sp|Q9Y3Q4|HCN4_HUMAN Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 OS=Homo sapiens GN=HCN4 PE=1 SV=1 14 202 2.0E-13
sp|Q9JKA7|HCN4_RAT Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 OS=Rattus norvegicus GN=Hcn4 PE=1 SV=1 14 202 2.0E-13
sp|O88704|HCN1_MOUSE Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 OS=Mus musculus GN=Hcn1 PE=1 SV=1 14 202 2.0E-13
sp|Q9TV66|HCN4_RABIT Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 OS=Oryctolagus cuniculus GN=HCN4 PE=2 SV=1 70 202 2.0E-13
sp|Q9JKB0|HCN1_RAT Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 OS=Rattus norvegicus GN=Hcn1 PE=2 SV=1 14 202 2.0E-13
sp|Q03041|CNGA2_BOVIN Cyclic nucleotide-gated olfactory channel OS=Bos taurus GN=CNGA2 PE=1 SV=1 22 193 3.0E-13
sp|Q62398|CNGA2_MOUSE Cyclic nucleotide-gated olfactory channel OS=Mus musculus GN=Cnga2 PE=2 SV=2 22 193 3.0E-13
sp|P29973|CNGA1_HUMAN cGMP-gated cation channel alpha-1 OS=Homo sapiens GN=CNGA1 PE=1 SV=3 15 193 3.0E-13
sp|Q9MZS1|HCN1_RABIT Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 OS=Oryctolagus cuniculus GN=HCN1 PE=2 SV=2 14 202 3.0E-13
sp|O88705|HCN3_MOUSE Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 OS=Mus musculus GN=Hcn3 PE=1 SV=1 14 236 3.0E-13
sp|Q00195|CNGA2_RAT Cyclic nucleotide-gated olfactory channel OS=Rattus norvegicus GN=Cnga2 PE=1 SV=1 22 193 3.0E-13
sp|Q8NEE6|FXL13_HUMAN F-box/LRR-repeat protein 13 OS=Homo sapiens GN=FBXL13 PE=2 SV=3 807 980 4.0E-13
sp|Q9JJZ8|CNGA3_MOUSE Cyclic nucleotide-gated cation channel alpha-3 OS=Mus musculus GN=Cnga3 PE=1 SV=2 22 193 4.0E-13
sp|Q9P1Z3|HCN3_HUMAN Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 OS=Homo sapiens GN=HCN3 PE=2 SV=2 14 236 4.0E-13
sp|Q28279|CNGA1_CANLF cGMP-gated cation channel alpha-1 OS=Canis lupus familiaris GN=CNGA1 PE=2 SV=1 15 193 4.0E-13
sp|Q8LB33|FB330_ARATH F-box protein At3g58530 OS=Arabidopsis thaliana GN=At3g58530 PE=2 SV=1 667 981 6.0E-13
sp|Q00194|CNGA1_BOVIN cGMP-gated cation channel alpha-1 OS=Bos taurus GN=CNGA1 PE=1 SV=1 15 193 7.0E-13
sp|Q9UJT9|FBXL7_HUMAN F-box/LRR-repeat protein 7 OS=Homo sapiens GN=FBXL7 PE=2 SV=1 803 980 8.0E-13
sp|Q8MJD7|CNGB3_CANLF Cyclic nucleotide-gated cation channel beta-3 OS=Canis lupus familiaris GN=CNGB3 PE=1 SV=1 51 217 8.0E-13
sp|Q9JKA8|HCN3_RAT Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 OS=Rattus norvegicus GN=Hcn3 PE=1 SV=1 14 202 8.0E-13
sp|Q28718|CNGA2_RABIT Cyclic nucleotide-gated olfactory channel OS=Oryctolagus cuniculus GN=CNGA2 PE=2 SV=1 22 193 9.0E-13
sp|Q29441|CNGA3_BOVIN Cyclic nucleotide-gated cation channel alpha-3 OS=Bos taurus GN=CNGA3 PE=2 SV=1 22 209 9.0E-13
sp|Q5BJ29|FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus GN=Fbxl7 PE=1 SV=1 803 980 1.0E-12
sp|Q16281|CNGA3_HUMAN Cyclic nucleotide-gated cation channel alpha-3 OS=Homo sapiens GN=CNGA3 PE=1 SV=2 22 209 1.0E-12
sp|Q16280|CNGA2_HUMAN Cyclic nucleotide-gated olfactory channel OS=Homo sapiens GN=CNGA2 PE=2 SV=2 22 193 1.0E-12
sp|Q90980|CNG3_CHICK Cyclic nucleotide-gated channel rod photoreceptor subunit alpha OS=Gallus gallus PE=2 SV=1 15 195 3.0E-12
sp|Q64359|CNGA4_RAT Cyclic nucleotide-gated cation channel alpha-4 OS=Rattus norvegicus GN=Cnga4 PE=2 SV=1 51 208 3.0E-12
sp|Q3UW12|CNGA4_MOUSE Cyclic nucleotide-gated cation channel alpha-4 OS=Mus musculus GN=Cnga4 PE=2 SV=1 51 208 3.0E-12
sp|Q8N1E6|FXL14_HUMAN F-box/LRR-repeat protein 14 OS=Homo sapiens GN=FBXL14 PE=1 SV=1 801 977 4.0E-12
sp|Q8BID8|FXL14_MOUSE F-box/LRR-repeat protein 14 OS=Mus musculus GN=Fbxl14 PE=2 SV=1 801 977 6.0E-12
sp|Q17R01|FXL14_BOVIN F-box/LRR-repeat protein 14 OS=Bos taurus GN=FBXL14 PE=2 SV=1 801 977 6.0E-12
sp|Q8CDU4|FXL13_MOUSE F-box/LRR-repeat protein 13 OS=Mus musculus GN=Fbxl13 PE=2 SV=2 807 980 6.0E-12
sp|Q62927|CNGA1_RAT cGMP-gated cation channel alpha-1 OS=Rattus norvegicus GN=Cnga1 PE=2 SV=1 15 193 7.0E-12
sp|P29974|CNGA1_MOUSE cGMP-gated cation channel alpha-1 OS=Mus musculus GN=Cnga1 PE=2 SV=2 15 193 8.0E-12
sp|E6ZHJ8|FXL15_DICLA F-box/LRR-repeat protein 15 OS=Dicentrarchus labrax GN=fbxl15 PE=3 SV=1 810 980 9.0E-12
sp|Q8IV77|CNGA4_HUMAN Cyclic nucleotide-gated cation channel alpha-4 OS=Homo sapiens GN=CNGA4 PE=1 SV=3 51 208 3.0E-11
sp|O49286|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1 810 977 4.0E-11
sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 651 992 5.0E-11
sp|O70507|HCN4_MOUSE Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 OS=Mus musculus GN=Hcn4 PE=1 SV=2 14 194 5.0E-11
sp|A6H779|FBXL2_BOVIN F-box/LRR-repeat protein 2 OS=Bos taurus GN=FBXL2 PE=2 SV=1 810 980 8.0E-11
sp|Q03611|CNG_CAEEL Cyclic nucleotide-gated cation channel OS=Caenorhabditis elegans GN=tax-4 PE=2 SV=3 49 206 1.0E-10
sp|Q6NW95|FXL15_DANRE F-box/LRR-repeat protein 15 OS=Danio rerio GN=fbxl15 PE=2 SV=2 863 980 1.0E-10
sp|A6H779|FBXL2_BOVIN F-box/LRR-repeat protein 2 OS=Bos taurus GN=FBXL2 PE=2 SV=1 807 977 2.0E-10
sp|A2RT62|FXL16_MOUSE F-box/LRR-repeat protein 16 OS=Mus musculus GN=Fbxl16 PE=1 SV=1 808 963 2.0E-10
sp|Q5MJ12|FXL16_RAT F-box/LRR-repeat protein 16 OS=Rattus norvegicus GN=Fbxl16 PE=2 SV=1 808 963 2.0E-10
sp|Q7SZ73|FXL15_XENLA F-box/LRR-repeat protein 15 OS=Xenopus laevis GN=fbxl15 PE=2 SV=1 810 980 2.0E-10
sp|Q9NQW8|CNGB3_HUMAN Cyclic nucleotide-gated cation channel beta-3 OS=Homo sapiens GN=CNGB3 PE=1 SV=2 51 217 3.0E-10
sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 807 980 4.0E-10
sp|B5X441|FXL15_SALSA F-box/LRR-repeat protein 15 OS=Salmo salar GN=fbxl15 PE=2 SV=1 798 980 4.0E-10
sp|Q14028|CNGB1_HUMAN Cyclic nucleotide-gated cation channel beta-1 OS=Homo sapiens GN=CNGB1 PE=1 SV=2 61 213 4.0E-10
sp|Q28181|CNGB1_BOVIN Cyclic nucleotide-gated cation channel beta-1 OS=Bos taurus GN=CNGB1 PE=1 SV=1 61 213 5.0E-10
sp|Q9LPL4|SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana GN=SKP2A PE=1 SV=1 823 980 6.0E-10
sp|Q9JJZ9|CNGB3_MOUSE Cyclic nucleotide-gated cation channel beta-3 OS=Mus musculus GN=Cngb3 PE=1 SV=1 51 194 7.0E-10
sp|Q8N461|FXL16_HUMAN F-box/LRR-repeat protein 16 OS=Homo sapiens GN=FBXL16 PE=2 SV=2 808 960 8.0E-10
sp|Q6C2X0|KAPR_YARLI cAMP-dependent protein kinase regulatory subunit OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PKAR PE=3 SV=1 87 175 1.0E-09
sp|Q9LPL4|SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana GN=SKP2A PE=1 SV=1 810 977 2.0E-09
sp|Q5XGC0|FXL15_XENTR F-box/LRR-repeat protein 15 OS=Xenopus tropicalis GN=fbxl15 PE=2 SV=1 810 980 3.0E-09
sp|Q9UF56|FXL17_HUMAN F-box/LRR-repeat protein 17 OS=Homo sapiens GN=FBXL17 PE=2 SV=3 602 977 3.0E-09
sp|Q9LPL4|SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana GN=SKP2A PE=1 SV=1 795 962 4.0E-09
sp|Q9QZH7|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1 781 969 5.0E-09
sp|Q8CDU4|FXL13_MOUSE F-box/LRR-repeat protein 13 OS=Mus musculus GN=Fbxl13 PE=2 SV=2 707 980 9.0E-09
sp|P24814|GRR1_YEAST SCF E3 ubiquitin ligase complex F-box protein GRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRR1 PE=1 SV=1 660 980 9.0E-09
sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 821 980 1.0E-08
sp|O49286|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1 806 937 1.0E-08
sp|Q91W61|FXL15_MOUSE F-box/LRR-repeat protein 15 OS=Mus musculus GN=Fbxl15 PE=1 SV=2 806 924 2.0E-08
sp|Q5R3Z8|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1 821 980 3.0E-08
sp|Q9UKC9|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3 821 980 3.0E-08
sp|E1BNS0|FXL15_BOVIN F-box/LRR-repeat protein 15 OS=Bos taurus GN=FBXL15 PE=3 SV=1 806 924 3.0E-08
sp|Q75AM2|KAPR_ASHGO cAMP-dependent protein kinase regulatory subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKAR PE=3 SV=1 68 175 3.0E-08
sp|Q8BH70|FBXL4_MOUSE F-box/LRR-repeat protein 4 OS=Mus musculus GN=Fbxl4 PE=1 SV=1 807 981 3.0E-08
sp|Q0VD31|FBXL4_BOVIN F-box/LRR-repeat protein 4 OS=Bos taurus GN=FBXL4 PE=2 SV=1 807 981 3.0E-08
sp|Q9UKA2|FBXL4_HUMAN F-box/LRR-repeat protein 4 OS=Homo sapiens GN=FBXL4 PE=1 SV=2 807 981 3.0E-08
sp|D4ABB4|FXL15_RAT F-box/LRR-repeat protein 15 OS=Rattus norvegicus GN=Fbxl15 PE=3 SV=1 806 924 3.0E-08
sp|Q9LPL4|SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana GN=SKP2A PE=1 SV=1 806 937 4.0E-08
sp|E2RKN7|FXL15_CANLF F-box/LRR-repeat protein 15 OS=Canis lupus familiaris GN=FBXL15 PE=3 SV=1 806 924 5.0E-08
sp|O49286|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1 795 962 6.0E-08
sp|Q9QZN1|FXL17_MOUSE F-box/LRR-repeat protein 17 OS=Mus musculus GN=Fbxl17 PE=2 SV=3 555 977 6.0E-08
sp|Q9H469|FXL15_HUMAN F-box/LRR-repeat protein 15 OS=Homo sapiens GN=FBXL15 PE=1 SV=2 806 924 6.0E-08
sp|Q26619|KAPR_STRPU cAMP-dependent protein kinase type II regulatory subunit OS=Strongylocentrotus purpuratus PE=2 SV=1 66 204 7.0E-08
sp|Q2K5E1|CNGK1_RHIEC Cyclic nucleotide-gated potassium channel RHE_CH03180 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=RHE_CH03180 PE=3 SV=1 70 192 7.0E-08
sp|P07278|KAPR_YEAST cAMP-dependent protein kinase regulatory subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCY1 PE=1 SV=4 68 175 7.0E-08
sp|Q8NEE6|FXL13_HUMAN F-box/LRR-repeat protein 13 OS=Homo sapiens GN=FBXL13 PE=2 SV=3 803 964 8.0E-08
sp|Q24278|CNGA_DROME Cyclic nucleotide-gated cation channel subunit A OS=Drosophila melanogaster GN=CngA PE=2 SV=2 51 198 8.0E-08
sp|Q9QZH7|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1 864 981 1.0E-07
sp|Q91W61|FXL15_MOUSE F-box/LRR-repeat protein 15 OS=Mus musculus GN=Fbxl15 PE=1 SV=2 810 1042 1.0E-07
sp|P24814|GRR1_YEAST SCF E3 ubiquitin ligase complex F-box protein GRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRR1 PE=1 SV=1 801 975 2.0E-07
sp|Q5U201|AMN1_RAT Protein AMN1 homolog OS=Rattus norvegicus GN=Amn1 PE=2 SV=2 808 969 2.0E-07
sp|Q8RWU5|FBL3_ARATH F-box/LRR-repeat protein 3 OS=Arabidopsis thaliana GN=FBL3 PE=2 SV=1 672 1012 3.0E-07
sp|Q9SRR1|FBL12_ARATH F-box/LRR-repeat protein 12 OS=Arabidopsis thaliana GN=FBL12 PE=2 SV=1 857 996 4.0E-07
sp|P81900|KAPR2_DROME cAMP-dependent protein kinase type II regulatory subunit OS=Drosophila melanogaster GN=Pka-R2 PE=1 SV=2 66 204 4.0E-07
sp|D4ABB4|FXL15_RAT F-box/LRR-repeat protein 15 OS=Rattus norvegicus GN=Fbxl15 PE=3 SV=1 836 1042 5.0E-07
sp|Q7SZ73|FXL15_XENLA F-box/LRR-repeat protein 15 OS=Xenopus laevis GN=fbxl15 PE=2 SV=1 803 936 7.0E-07
sp|E2RKN7|FXL15_CANLF F-box/LRR-repeat protein 15 OS=Canis lupus familiaris GN=FBXL15 PE=3 SV=1 836 1042 7.0E-07
sp|Q9C1C2|KAPR_COLOR cAMP-dependent protein kinase regulatory subunit OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=PKAR PE=3 SV=1 68 175 7.0E-07
sp|E1BNS0|FXL15_BOVIN F-box/LRR-repeat protein 15 OS=Bos taurus GN=FBXL15 PE=3 SV=1 810 980 8.0E-07
sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 803 976 9.0E-07
sp|Q98GN8|CNGK1_RHILO Cyclic nucleotide-gated potassium channel mll3241 OS=Rhizobium loti (strain MAFF303099) GN=mll3241 PE=1 SV=1 70 192 9.0E-07
sp|O49286|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1 823 980 1.0E-06
sp|Q9H469|FXL15_HUMAN F-box/LRR-repeat protein 15 OS=Homo sapiens GN=FBXL15 PE=1 SV=2 810 1042 1.0E-06
sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 666 977 1.0E-06
sp|Q708Y0|EBF2_ARATH EIN3-binding F-box protein 2 OS=Arabidopsis thaliana GN=EBF2 PE=1 SV=1 801 977 2.0E-06
sp|Q5XGC0|FXL15_XENTR F-box/LRR-repeat protein 15 OS=Xenopus tropicalis GN=fbxl15 PE=2 SV=1 803 936 3.0E-06
sp|Q9M8S6|SKOR_ARATH Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 57 191 4.0E-06
sp|A2RT62|FXL16_MOUSE F-box/LRR-repeat protein 16 OS=Mus musculus GN=Fbxl16 PE=1 SV=1 802 924 7.0E-06
sp|Q653P0|KOR1_ORYSJ Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 57 203 7.0E-06
sp|Q5MJ12|FXL16_RAT F-box/LRR-repeat protein 16 OS=Rattus norvegicus GN=Fbxl16 PE=2 SV=1 802 924 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3858
MRRGRSAGAASPYRALAHHHHHHNQQQQVPSDSTLIRSFDVDANPARPVRPSPLATSVIRDMPLDLVDRIRSFPL
FQSAPGDFLIAIGNHLKPQIHAPNDHVVTEGDDARAMYWLVRGVVAVTSRDGEAVYAELKPGAFFGEIGVLMNMP
RTATIVARTKCLLLVLKKEDLQLVLPRFPDMEQAILEEAQERLSLLKKKKRIERPAAQSCPPRWPVAAEAGGSES
GAIMDGAVVKNPKKRKSPSPGIIQDPASSGSAIGSGLVSIRKTLKELPLFSTLPPDILHFLGLSVAPKSFPPFTD
IIRQGSSGNEIYFIVQGEAEVVYRDQPECTQDDAAAISPIQPRPRLRAGQYFGEVASLGLSPGRTATVRSITTVE
CLVVPGETLEELWRRCPPSIRSQVEETARERYSEVRQSDGPWDIDMADTAKAADTDSGLSDTPKTPPKTPSPAKG
RGYVAASMFTVPSSPQPSPISKDDQADMMGPRDPDPFRSVDMENLRNRRRQSLVPLTTTTTTTTTTTTAPLTESP
TSKTPARPNGGVSRPLRVLTADVTSSPTKTESSPEGGPAGARFKRAKTVPSQGQAQDEGCEDECSAAAVVAARSD
DILVRIFRHLDVGHLVRLRIVSRRWRQILETSPLVCNDVDLSGYSRRVNDDVIVSVLGPFVGTRAESVDLNGCYH
ISDRGFSALWSSCGKNVKRWKMRSVWDVSATQILEMCENAKSLEELDWSNCRKVGDNLLARVVGWVIVPKKENAA
QQMLSNQASQPSDEKKKASIKTRSRTPDAPVRECEGDGDGESKTGSVEAPSNIVVGCPRLSKLDLSYCKHVTDRS
MAHLAAHASNRLQWLSLTRCTSITDAGFQAWAHHKFERLTHLYLADCTYLSDSAIVSLASAAKQLTHLDLSFCCA
LSDTATEVLALRLPKLRELRLAFCGSAVSDMSLQSIALHLGQLEGLSVRGCVRVTGRGLESVLEGCARLAWVDVS
QCRNLEAWLRSGSVARWGFDDRAKKPPPSPRATSGDGRGQGVDVPMHTPLSVATMLATPGFFPRSHLGSFFLGRR
AKRQPVRFIVQKSMQGLR*
Coding >Ophun1|3858
ATGAGGCGCGGCCGCTCCGCCGGTGCCGCCTCGCCCTACAGAGCGCTGGCCCATCATCATCACCACCACAATCAG
CAGCAGCAGGTTCCCTCAGACTCTACCCTCATCCGCTCCTTCGATGTCGACGCGAATCCGGCTCGTCCGGTCCGG
CCCTCTCCCTTGGCGACTTCGGTCATCCGCGACATGCCTCTCGACCTCGTCGACCGCATTCGCTCGTTCCCGCTC
TTCCAGTCGGCGCCCGGCGATTTCCTCATCGCTATAGGCAACCATCTCAAGCCTCAGATACACGCGCCCAACGAT
CATGTCGTCACAGAGGGCGATGACGCGAGGGCCATGTATTGGCTCGTCCGCGGCGTCGTCGCCGTCACCTCGCGT
GACGGTGAGGCCGTCTACGCTGAGCTCAAGCCCGGTGCCTTTTTCGGCGAGATTGGCGTCCTCATGAACATGCCT
CGTACCGCCACCATCGTCGCCCGGACCAAGTGCCTCCTGCTTGTCCTCAAAAAGGAAGACCTGCAGCTGGTGCTG
CCGCGCTTCCCCGACATGGAGCAGGCCATCTTGGAGGAGGCCCAGGAGCGGCTCAGCCTGCTCAAGAAGAAGAAG
AGGATAGAGAGGCCCGCCGCCCAGTCTTGTCCGCCCAGATGGCCTGTCGCCGCCGAGGCTGGAGGAAGCGAGAGT
GGCGCCATCATGGACGGTGCCGTCGTCAAGAACCCCAAGAAGCGCAAGTCCCCGAGTCCCGGCATCATCCAAGAC
CCGGCTTCCAGCGGCAGCGCCATCGGCAGCGGCCTCGTCAGCATCCGGAAGACGCTCAAGGAGCTCCCCCTCTTC
TCCACACTGCCCCCAGACATCCTCCACTTCCTGGGTCTCAGTGTTGCACCAAAGTCATTCCCTCCCTTTACCGAC
ATCATTCGCCAGGGCAGCTCCGGCAACGAGATCTACTTCATCGTACAGGGCGAGGCCGAGGTCGTCTATCGCGAC
CAGCCCGAGTGCACGCAAGACGATGCCGCCGCCATCAGCCCCATCCAACCCCGTCCGCGGCTCCGGGCCGGCCAG
TACTTTGGCGAGGTCGCGAGCCTCGGCCTTTCTCCCGGTCGGACGGCTACGGTGCGGTCGATAACGACGGTGGAA
TGTCTGGTCGTCCCGGGGGAGACGCTAGAGGAGCTGTGGCGACGATGCCCTCCCAGCATCAGGTCTCAGGTGGAG
GAGACGGCGCGGGAGCGCTACAGCGAAGTTCGGCAGTCCGACGGCCCCTGGGATATCGACATGGCCGACACAGCC
AAGGCCGCCGACACGGACTCTGGCTTGTCGGATACGCCCAAGACGCCGCCCAAGACGCCTTCGCCGGCCAAGGGA
AGGGGATACGTGGCAGCCTCCATGTTTACCGTACCTTCGAGTCCACAGCCCAGTCCGATTTCCAAGGATGACCAG
GCAGACATGATGGGGCCCCGGGATCCGGATCCCTTTCGCAGCGTCGACATGGAGAACCTGAGAAACCGCCGGCGG
CAGTCTCTGGTCCCGCTGACGACTACGACGACGACAACGACAACGACAACGACGGCGCCGCTGACGGAGAGCCCG
ACATCGAAGACGCCTGCCCGGCCCAATGGCGGCGTCTCGCGCCCCCTCCGCGTCCTCACCGCGGACGTGACGTCG
TCGCCAACCAAAACCGAGTCATCCCCGGAGGGTGGCCCGGCGGGCGCACGCTTCAAGAGGGCCAAGACGGTGCCG
TCACAAGGACAGGCCCAAGACGAGGGCTGCGAAGACGAGTGCTCGGCCGCTGCCGTCGTCGCCGCGCGGTCGGAC
GATATCCTCGTGCGCATCTTCAGGCATCTCGATGTCGGGCATCTCGTCAGGCTTCGCATCGTGAGCAGGCGCTGG
CGCCAGATCCTCGAGACGTCGCCGCTGGTCTGCAATGACGTCGACCTGTCCGGATACAGCCGCAGAGTCAACGAC
GACGTCATCGTCAGCGTCCTCGGCCCCTTCGTCGGCACCCGCGCCGAGAGCGTGGATCTCAACGGCTGCTACCAC
ATTTCCGACAGGGGCTTCTCGGCCCTCTGGAGCAGTTGCGGCAAGAACGTCAAGAGATGGAAGATGCGCTCCGTC
TGGGACGTCTCGGCCACGCAGATCCTGGAGATGTGCGAGAACGCGAAGAGCCTGGAGGAGCTGGACTGGAGCAAC
TGCCGCAAGGTGGGAGACAATCTACTGGCCCGCGTCGTCGGATGGGTCATTGTCCCCAAGAAGGAGAACGCGGCG
CAGCAGATGCTCTCCAATCAGGCAAGCCAGCCGTCTGACGAAAAGAAAAAGGCCAGTATCAAGACGCGGAGCCGG
ACTCCGGACGCTCCGGTCCGGGAATGCGAAGGCGACGGCGACGGCGAGTCCAAGACTGGATCCGTGGAAGCGCCC
AGCAACATCGTCGTCGGGTGCCCGAGGCTCAGCAAGCTCGACTTGTCCTACTGCAAGCATGTCACGGACCGGTCC
ATGGCTCACCTGGCCGCACACGCCTCGAACCGGCTGCAATGGCTCTCGCTGACCAGATGCACCTCGATCACGGAC
GCCGGCTTCCAGGCCTGGGCTCATCACAAGTTCGAAAGGCTGACGCACCTCTACCTCGCCGACTGCACATATCTG
TCAGACAGCGCCATCGTCTCGCTCGCCTCGGCCGCCAAGCAGTTGACGCACCTGGACCTGTCGTTTTGCTGCGCC
CTGTCGGACACGGCGACCGAGGTCCTCGCCCTGAGGCTGCCCAAGCTGCGGGAGCTCAGGCTCGCCTTTTGCGGC
AGCGCCGTCAGCGACATGAGCCTACAGAGCATCGCGCTACATCTCGGCCAGCTGGAGGGTCTCAGCGTGCGCGGC
TGCGTCAGGGTCACGGGCCGGGGCCTGGAGAGTGTGCTAGAGGGGTGCGCGCGACTCGCGTGGGTGGATGTGAGC
CAGTGTCGCAACCTCGAGGCCTGGCTGCGGTCTGGCAGCGTCGCCAGATGGGGGTTCGATGACCGGGCGAAGAAG
CCGCCGCCGTCGCCACGCGCAACCTCGGGCGATGGGAGGGGACAGGGAGTTGATGTGCCGATGCATACGCCGTTG
AGCGTGGCGACGATGCTCGCGACGCCGGGCTTCTTCCCGCGCTCGCACCTCGGCAGCTTCTTCCTCGGGCGAAGG
GCCAAGAGGCAACCGGTCAGGTTCATCGTGCAAAAGAGCATGCAGGGACTGAGATAG
Transcript >Ophun1|3858
ATGAGGCGCGGCCGCTCCGCCGGTGCCGCCTCGCCCTACAGAGCGCTGGCCCATCATCATCACCACCACAATCAG
CAGCAGCAGGTTCCCTCAGACTCTACCCTCATCCGCTCCTTCGATGTCGACGCGAATCCGGCTCGTCCGGTCCGG
CCCTCTCCCTTGGCGACTTCGGTCATCCGCGACATGCCTCTCGACCTCGTCGACCGCATTCGCTCGTTCCCGCTC
TTCCAGTCGGCGCCCGGCGATTTCCTCATCGCTATAGGCAACCATCTCAAGCCTCAGATACACGCGCCCAACGAT
CATGTCGTCACAGAGGGCGATGACGCGAGGGCCATGTATTGGCTCGTCCGCGGCGTCGTCGCCGTCACCTCGCGT
GACGGTGAGGCCGTCTACGCTGAGCTCAAGCCCGGTGCCTTTTTCGGCGAGATTGGCGTCCTCATGAACATGCCT
CGTACCGCCACCATCGTCGCCCGGACCAAGTGCCTCCTGCTTGTCCTCAAAAAGGAAGACCTGCAGCTGGTGCTG
CCGCGCTTCCCCGACATGGAGCAGGCCATCTTGGAGGAGGCCCAGGAGCGGCTCAGCCTGCTCAAGAAGAAGAAG
AGGATAGAGAGGCCCGCCGCCCAGTCTTGTCCGCCCAGATGGCCTGTCGCCGCCGAGGCTGGAGGAAGCGAGAGT
GGCGCCATCATGGACGGTGCCGTCGTCAAGAACCCCAAGAAGCGCAAGTCCCCGAGTCCCGGCATCATCCAAGAC
CCGGCTTCCAGCGGCAGCGCCATCGGCAGCGGCCTCGTCAGCATCCGGAAGACGCTCAAGGAGCTCCCCCTCTTC
TCCACACTGCCCCCAGACATCCTCCACTTCCTGGGTCTCAGTGTTGCACCAAAGTCATTCCCTCCCTTTACCGAC
ATCATTCGCCAGGGCAGCTCCGGCAACGAGATCTACTTCATCGTACAGGGCGAGGCCGAGGTCGTCTATCGCGAC
CAGCCCGAGTGCACGCAAGACGATGCCGCCGCCATCAGCCCCATCCAACCCCGTCCGCGGCTCCGGGCCGGCCAG
TACTTTGGCGAGGTCGCGAGCCTCGGCCTTTCTCCCGGTCGGACGGCTACGGTGCGGTCGATAACGACGGTGGAA
TGTCTGGTCGTCCCGGGGGAGACGCTAGAGGAGCTGTGGCGACGATGCCCTCCCAGCATCAGGTCTCAGGTGGAG
GAGACGGCGCGGGAGCGCTACAGCGAAGTTCGGCAGTCCGACGGCCCCTGGGATATCGACATGGCCGACACAGCC
AAGGCCGCCGACACGGACTCTGGCTTGTCGGATACGCCCAAGACGCCGCCCAAGACGCCTTCGCCGGCCAAGGGA
AGGGGATACGTGGCAGCCTCCATGTTTACCGTACCTTCGAGTCCACAGCCCAGTCCGATTTCCAAGGATGACCAG
GCAGACATGATGGGGCCCCGGGATCCGGATCCCTTTCGCAGCGTCGACATGGAGAACCTGAGAAACCGCCGGCGG
CAGTCTCTGGTCCCGCTGACGACTACGACGACGACAACGACAACGACAACGACGGCGCCGCTGACGGAGAGCCCG
ACATCGAAGACGCCTGCCCGGCCCAATGGCGGCGTCTCGCGCCCCCTCCGCGTCCTCACCGCGGACGTGACGTCG
TCGCCAACCAAAACCGAGTCATCCCCGGAGGGTGGCCCGGCGGGCGCACGCTTCAAGAGGGCCAAGACGGTGCCG
TCACAAGGACAGGCCCAAGACGAGGGCTGCGAAGACGAGTGCTCGGCCGCTGCCGTCGTCGCCGCGCGGTCGGAC
GATATCCTCGTGCGCATCTTCAGGCATCTCGATGTCGGGCATCTCGTCAGGCTTCGCATCGTGAGCAGGCGCTGG
CGCCAGATCCTCGAGACGTCGCCGCTGGTCTGCAATGACGTCGACCTGTCCGGATACAGCCGCAGAGTCAACGAC
GACGTCATCGTCAGCGTCCTCGGCCCCTTCGTCGGCACCCGCGCCGAGAGCGTGGATCTCAACGGCTGCTACCAC
ATTTCCGACAGGGGCTTCTCGGCCCTCTGGAGCAGTTGCGGCAAGAACGTCAAGAGATGGAAGATGCGCTCCGTC
TGGGACGTCTCGGCCACGCAGATCCTGGAGATGTGCGAGAACGCGAAGAGCCTGGAGGAGCTGGACTGGAGCAAC
TGCCGCAAGGTGGGAGACAATCTACTGGCCCGCGTCGTCGGATGGGTCATTGTCCCCAAGAAGGAGAACGCGGCG
CAGCAGATGCTCTCCAATCAGGCAAGCCAGCCGTCTGACGAAAAGAAAAAGGCCAGTATCAAGACGCGGAGCCGG
ACTCCGGACGCTCCGGTCCGGGAATGCGAAGGCGACGGCGACGGCGAGTCCAAGACTGGATCCGTGGAAGCGCCC
AGCAACATCGTCGTCGGGTGCCCGAGGCTCAGCAAGCTCGACTTGTCCTACTGCAAGCATGTCACGGACCGGTCC
ATGGCTCACCTGGCCGCACACGCCTCGAACCGGCTGCAATGGCTCTCGCTGACCAGATGCACCTCGATCACGGAC
GCCGGCTTCCAGGCCTGGGCTCATCACAAGTTCGAAAGGCTGACGCACCTCTACCTCGCCGACTGCACATATCTG
TCAGACAGCGCCATCGTCTCGCTCGCCTCGGCCGCCAAGCAGTTGACGCACCTGGACCTGTCGTTTTGCTGCGCC
CTGTCGGACACGGCGACCGAGGTCCTCGCCCTGAGGCTGCCCAAGCTGCGGGAGCTCAGGCTCGCCTTTTGCGGC
AGCGCCGTCAGCGACATGAGCCTACAGAGCATCGCGCTACATCTCGGCCAGCTGGAGGGTCTCAGCGTGCGCGGC
TGCGTCAGGGTCACGGGCCGGGGCCTGGAGAGTGTGCTAGAGGGGTGCGCGCGACTCGCGTGGGTGGATGTGAGC
CAGTGTCGCAACCTCGAGGCCTGGCTGCGGTCTGGCAGCGTCGCCAGATGGGGGTTCGATGACCGGGCGAAGAAG
CCGCCGCCGTCGCCACGCGCAACCTCGGGCGATGGGAGGGGACAGGGAGTTGATGTGCCGATGCATACGCCGTTG
AGCGTGGCGACGATGCTCGCGACGCCGGGCTTCTTCCCGCGCTCGCACCTCGGCAGCTTCTTCCTCGGGCGAAGG
GCCAAGAGGCAACCGGTCAGGTTCATCGTGCAAAAGAGCATGCAGGGACTGAGATAG
Gene >Ophun1|3858
ATGAGGCGCGGCCGCTCCGCCGGTGCCGCCTCGCCCTACAGAGCGCTGGCCCATCATCATCACCACCACAATCAG
CAGCAGCAGGTTCCCTCAGACTCTACCCTCATCCGCTCCTTCGATGTCGACGCGAATCCGGCTCGTCCGGTCCGG
CCCTCTCCCTTGGCGACTTCGGTCATCCGCGACATGCCTCTCGACCTCGTCGACCGCATTCGCTCGTTCCCGCTC
TTCCAGTCGGCGCCCGGCGATTTCCTCATCGCTATAGGCAACCATCTCAAGCCTCAGATACACGCGCCCAACGAT
CATGTCGTCACAGAGGGCGATGACGCGAGGGCCATGTATTGGCTCGTCCGCGGCGTCGTCGCCGTCACCTCGCGT
GACGGTGAGGCCGTCTACGCTGAGCTCAAGCCCGGTGCCTTTTTCGGCGAGATTGGCGTCCTCATGAACATGCCT
CGTACCGCCACCATCGTCGCCCGGACCAAGTGCCTCCTGCTTGTCCTCAAAAAGGAAGACCTGCAGCTGGTGCTG
CCGCGCTTCCCCGACATGGAGCAGGCCATCTTGGAGGAGGCCCAGGAGCGGCTCAGCCTGCTCAAGAAGAAGAAG
AGGATAGAGAGGCCCGCCGCCCAGTCTTGTCCGCCCAGATGGCCTGTCGCCGCCGAGGCTGGAGGAAGCGAGAGT
GGCGCCATCATGGACGGTGCCGTCGTCAAGAACCCCAAGAAGCGCAAGTCCCCGAGTCCCGGCATCATCCAAGAC
CCGGCTTCCAGCGGCAGCGCCATCGGCAGCGGCCTCGTCAGCATCCGGAAGACGCTCAAGGAGCTCCCCCTCTTC
TCCACACTGCCCCCAGACATCCTCCACTTCCTGGGTCTCAGTGTTGCACCAAAGTCATTCCCTCCCTTTACCGAC
ATCATTCGCCAGGGCAGCTCCGGCAACGAGATCTACTTCATCGTACAGGGCGAGGCCGAGGTCGTCTATCGCGAC
CAGCCCGAGTGCACGCAAGACGATGCCGCCGCCATCAGCCCCATCCAACCCCGTCCGCGGCTCCGGGCCGGCCAG
TACTTTGGCGAGGTCGCGAGCCTCGGCCTTTCTCCCGGTCGGACGGCTACGGTGCGGTCGATAACGACGGTGGAA
TGTCTGGTCGTCCCGGGGGAGACGCTAGAGGAGCTGTGGCGACGATGCCCTCCCAGCATCAGGTCTCAGGTGGAG
GAGACGGCGCGGGAGCGCTACAGCGAAGTTCGGCAGTCCGACGGCCCCTGGGATATCGACATGGCCGACACAGCC
AAGGCCGCCGACACGGACTCTGGCTTGTCGGATACGCCCAAGACGCCGCCCAAGACGCCTTCGCCGGCCAAGGGA
AGGGGATACGTGGCAGCCTCCATGTTTACCGTACCTTCGAGTCCACAGCCCAGTCCGATTTCCAAGGATGACCAG
GCAGACATGATGGGGCCCCGGGATCCGGATCCCTTTCGCAGCGTCGACATGGAGAACCTGAGAAACCGCCGGCGG
CAGTCTCTGGTCCCGCTGACGACTACGACGACGACAACGACAACGACAACGACGGCGCCGCTGACGGAGAGCCCG
ACATCGAAGACGCCTGCCCGGCCCAATGGCGGCGTCTCGCGCCCCCTCCGCGTCCTCACCGCGGACGTGACGTCG
TCGCCAACCAAAACCGAGTCATCCCCGGAGGGTGGCCCGGCGGGCGCACGCTTCAAGAGGGCCAAGACGGTGCCG
TCACAAGGACAGGCCCAAGACGAGGGCTGCGAAGACGAGTGCTCGGCCGCTGCCGTCGTCGCCGCGCGGTCGGAC
GATATCCTCGTGCGCATCTTCAGGCATCTCGATGTCGGGCATCTCGTCAGGCTTCGCATCGTGAGCAGGCGCTGG
CGCCAGATCCTCGAGACGTCGCCGCTGGTCTGCAATGACGTCGACCTGTCCGGATACAGCCGCAGAGTCAACGAC
GACGTCATCGTCAGCGTCCTCGGCCCCTTCGTCGGCACCCGCGCCGAGAGCGTGGATCTCAACGGCTGCTACCAC
ATTTCCGACAGGGGCTTCTCGGCCCTCTGGAGCAGTTGCGGCAAGAACGTCAAGAGATGGAAGATGCGCTCCGTC
TGGGACGTCTCGGCCACGCAGATCCTGGAGATGTGCGAGAACGCGAAGAGCCTGGAGGAGCTGGACTGGAGCAAC
TGCCGCAAGGTGGGAGACAATCTACTGGCCCGCGTCGTCGGATGGGTCATTGTCCCCAAGAAGGAGAACGCGGCG
CAGCAGATGCTCTCCAATCAGGCAAGCCAGCCGTCTGACGAAAAGAAAAAGGCCAGTATCAAGACGCGGAGCCGG
ACTCCGGACGCTCCGGTCCGGGAATGCGAAGGCGACGGCGACGGCGAGTCCAAGACTGGATCCGTGGAAGCGCCC
AGCAACATCGTCGTCGGGTGCCCGAGGCTCAGCAAGCTCGACTTGTCCTACTGCAAGCATGTCACGGACCGGTCC
ATGGCTCACCTGGCCGCACACGCCTCGAACCGGCTGCAATGGCTCTCGCTGACCAGATGCACCTCGATCACGGAC
GCCGGCTTCCAGGCCTGGGCTCATCACAAGTTCGAAAGGCTGACGCACCTCTACCTCGCCGACTGCACATATCTG
TCAGACAGCGCCATCGTCTCGCTCGCCTCGGCCGCCAAGCAGTTGACGCACCTGGACCTGTCGTTTTGCTGCGCC
CTGTCGGACACGGCGACCGAGGTCCTCGCCCTGAGGCTGCCCAAGCTGCGGGAGCTCAGGCTCGCCTTTTGCGGC
AGCGCCGTCAGCGACATGAGCCTACAGAGCATCGCGCTACATCTCGGCCAGCTGGAGGGTCTCAGCGTGCGCGGC
TGCGTCAGGGTCACGGGCCGGGGCCTGGAGAGTGTGCTAGAGGGGTGCGCGCGACTCGCGTGGGTGGATGTGAGC
CAGTGTCGCAACCTCGAGGCCTGGCTGCGGTCTGGCAGCGTCGCCAGATGGGGGTTCGATGACCGGGCGAAGAAG
CCGCCGCCGTCGCCACGCGCAACCTCGGGCGATGGGAGGGGACAGGGAGTTGATGTGCCGATGCATACGCCGTTG
AGCGTGGCGACGATGCTCGCGACGCCGGGCTTCTTCCCGCGCTCGCACCTCGGCAGCTTCTTCCTCGGGCGAAGG
GCCAAGAGGCAACCGGTCAGGTTCATCGTGCAAAAGAGCATGCAGGGACTGAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail