Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3856
Gene name
LocationContig_348:10392..12312
Strand+
Gene length (bp)1920
Transcript length (bp)1863
Coding sequence length (bp)1863
Protein length (aa) 621

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00291 PALP Pyridoxal-phosphate dependent enzyme 4.0E-76 121 411
PF00585 Thr_dehydrat_C C-terminal regulatory domain of Threonine dehydratase 1.5E-17 426 520
PF00585 Thr_dehydrat_C C-terminal regulatory domain of Threonine dehydratase 5.0E-19 526 613

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94634|THDH_SCHPO Threonine dehydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1677.03c PE=3 SV=1 60 614 0.0E+00
sp|P00927|THDH_YEAST Threonine dehydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILV1 PE=1 SV=2 97 614 0.0E+00
sp|O42615|THDH_BLAAD Threonine dehydratase, mitochondrial OS=Blastobotrys adeninivorans GN=ILV1 PE=3 SV=1 73 612 0.0E+00
sp|P53607|ILVA_BURM1 L-threonine dehydratase biosynthetic IlvA OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ilvA PE=3 SV=1 106 613 2.0E-151
sp|P46493|ILVA_HAEIN L-threonine dehydratase biosynthetic IlvA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ilvA PE=3 SV=1 106 614 3.0E-146
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94634|THDH_SCHPO Threonine dehydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1677.03c PE=3 SV=1 60 614 0.0E+00
sp|P00927|THDH_YEAST Threonine dehydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILV1 PE=1 SV=2 97 614 0.0E+00
sp|O42615|THDH_BLAAD Threonine dehydratase, mitochondrial OS=Blastobotrys adeninivorans GN=ILV1 PE=3 SV=1 73 612 0.0E+00
sp|P53607|ILVA_BURM1 L-threonine dehydratase biosynthetic IlvA OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ilvA PE=3 SV=1 106 613 2.0E-151
sp|P46493|ILVA_HAEIN L-threonine dehydratase biosynthetic IlvA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ilvA PE=3 SV=1 106 614 3.0E-146
sp|Q9CKJ2|ILVA_PASMU L-threonine dehydratase biosynthetic IlvA OS=Pasteurella multocida (strain Pm70) GN=ilvA PE=3 SV=1 100 613 6.0E-144
sp|P20506|ILVA_SALTY L-Threonine dehydratase biosynthetic IlvA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ilvA PE=3 SV=3 101 613 2.0E-136
sp|P04968|ILVA_ECOLI L-threonine dehydratase biosynthetic IlvA OS=Escherichia coli (strain K12) GN=ilvA PE=1 SV=1 102 613 7.0E-136
sp|Q9ZSS6|THD1_ARATH Threonine dehydratase biosynthetic, chloroplastic OS=Arabidopsis thaliana GN=OMR1 PE=1 SV=1 106 613 7.0E-134
sp|P25306|THD1_SOLLC Threonine dehydratase biosynthetic, chloroplastic OS=Solanum lycopersicum GN=TD PE=1 SV=1 81 601 1.0E-118
sp|Q39469|THD1_CICAR Threonine dehydratase biosynthetic, chloroplastic OS=Cicer arietinum PE=2 SV=1 105 601 2.0E-103
sp|Q8CNK9|ILVA_STAES L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ilvA PE=3 SV=2 111 500 6.0E-78
sp|Q5HMF5|ILVA_STAEQ L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ilvA PE=3 SV=1 111 500 6.0E-78
sp|P31212|THD1_SOLTU Threonine dehydratase biosynthetic (Fragment) OS=Solanum tuberosum GN=TD PE=2 SV=1 249 601 3.0E-72
sp|Q5HEE0|ILVA_STAAC L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain COL) GN=ilvA PE=3 SV=1 111 504 8.0E-69
sp|Q2FWJ9|ILVA_STAA8 L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain NCTC 8325) GN=ilvA PE=3 SV=1 111 504 8.0E-69
sp|Q2FF63|ILVA_STAA3 L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain USA300) GN=ilvA PE=3 SV=1 111 504 8.0E-69
sp|Q8NVI8|ILVA_STAAW L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain MW2) GN=ilvA PE=3 SV=1 111 504 9.0E-69
sp|Q3V7T4|ILVA_STAAS L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain MSSA476) GN=ilvA PE=3 SV=1 111 504 9.0E-69
sp|Q7A4H2|ILVA_STAAN L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain N315) GN=ilvA PE=3 SV=1 111 504 1.0E-68
sp|Q99SJ1|ILVA_STAAM L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ilvA PE=3 SV=1 111 504 1.0E-68
sp|Q3V7T5|ILVA_STAAR L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain MRSA252) GN=ilvA PE=3 SV=1 111 504 2.0E-68
sp|Q4L7U4|ILVA_STAHJ L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ilvA PE=3 SV=1 111 496 2.0E-68
sp|Q49Z16|ILVA_STAS1 L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ilvA PE=3 SV=1 111 482 2.0E-68
sp|Q2YUE8|ILVA_STAAB L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ilvA PE=3 SV=1 111 504 1.0E-67
sp|P37946|ILVA_BACSU L-threonine dehydratase biosynthetic IlvA OS=Bacillus subtilis (strain 168) GN=ilvA PE=3 SV=1 108 514 6.0E-67
sp|Q9KC63|ILVA_BACHD L-threonine dehydratase biosynthetic IlvA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ilvA PE=3 SV=1 125 514 2.0E-64
sp|Q02145|ILVA_LACLA L-threonine dehydratase biosynthetic IlvA OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ilvA PE=3 SV=3 125 514 1.0E-58
sp|P9WG95|ILVA_MYCTU L-threonine dehydratase biosynthetic IlvA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ilvA PE=1 SV=1 111 510 8.0E-54
sp|P9WG94|ILVA_MYCTO L-threonine dehydratase biosynthetic IlvA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ilvA PE=3 SV=1 111 510 8.0E-54
sp|P66898|ILVA_MYCBO L-threonine dehydratase biosynthetic IlvA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ilvA PE=3 SV=1 111 510 8.0E-54
sp|Q9X7F1|ILVA_MYCLE L-threonine dehydratase biosynthetic IlvA OS=Mycobacterium leprae (strain TN) GN=ilvA PE=3 SV=1 111 511 2.0E-48
sp|Q04513|ILVA_CORGL L-threonine dehydratase biosynthetic IlvA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ilvA PE=3 SV=2 111 500 2.0E-47
sp|Q8NWQ4|TDCB_STAAW L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain MW2) GN=tdcB PE=3 SV=1 111 427 3.0E-46
sp|Q6G9C4|TDCB_STAAS L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain MSSA476) GN=tdcB PE=3 SV=1 111 427 3.0E-46
sp|Q6GGX0|TDCB_STAAR L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain MRSA252) GN=tdcB PE=3 SV=1 111 427 3.0E-46
sp|Q5HFY5|TDCB_STAAC L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain COL) GN=tdcB PE=3 SV=1 111 427 3.0E-46
sp|Q2FYJ3|TDCB_STAA8 L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain NCTC 8325) GN=tdcB PE=3 SV=1 111 427 3.0E-46
sp|Q2FH01|TDCB_STAA3 L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain USA300) GN=tdcB PE=3 SV=1 111 427 3.0E-46
sp|Q2YY67|TDCB_STAAB L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=tdcB PE=3 SV=2 111 427 2.0E-45
sp|Q7A5L8|TDCB_STAAN L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain N315) GN=tdcB PE=1 SV=1 111 427 3.0E-45
sp|O59791|SRR_SCHPO Serine racemase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SRR PE=1 SV=1 97 420 3.0E-45
sp|Q99U50|TDCB_STAAM L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=tdcB PE=3 SV=1 111 427 3.0E-45
sp|Q74FW6|TSAL_GEOSL L-threonine ammonia-lyase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=tdcB PE=1 SV=1 110 456 4.0E-45
sp|P0AGF6|TDCB_ECOLI L-threonine dehydratase catabolic TdcB OS=Escherichia coli (strain K12) GN=tdcB PE=1 SV=1 100 421 1.0E-43
sp|P0AGF7|TDCB_ECOL6 L-threonine dehydratase catabolic TdcB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tdcB PE=3 SV=1 100 421 1.0E-43
sp|P0AGF8|TDCB_ECO57 L-threonine dehydratase catabolic TdcB OS=Escherichia coli O157:H7 GN=tdcB PE=3 SV=1 100 421 1.0E-43
sp|P0AGF9|TDCB_SHIFL L-threonine dehydratase catabolic TdcB OS=Shigella flexneri GN=tdcB PE=3 SV=1 100 421 1.0E-43
sp|P11954|TDCB_SALTY L-threonine dehydratase catabolic TdcB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=tdcB PE=1 SV=2 100 421 3.0E-43
sp|P36007|SRY1_YEAST Threo-3-hydroxyaspartate ammonia-lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRY1 PE=1 SV=1 98 435 2.0E-42
sp|Q7XSN8|SRR_ORYSJ Serine racemase OS=Oryza sativa subsp. japonica GN=SERR PE=1 SV=2 103 421 4.0E-39
sp|A2XWA9|SRR_ORYSI Serine racemase OS=Oryza sativa subsp. indica GN=OsI_16936 PE=3 SV=1 103 421 4.0E-39
sp|Q2PGG3|SRR_ARATH Serine racemase OS=Arabidopsis thaliana GN=SR PE=1 SV=1 111 421 6.0E-39
sp|Q10725|FSDH_RALPI Phenylserine dehydratase OS=Ralstonia pickettii GN=psdht PE=1 SV=3 105 391 5.0E-37
sp|P55664|Y4TJ_RHISN Putative threonine dehydratase OS=Rhizobium sp. (strain NGR234) GN=NGR_a01490 PE=3 SV=1 108 424 1.0E-36
sp|Q9GZT4|SRR_HUMAN Serine racemase OS=Homo sapiens GN=SRR PE=1 SV=1 111 418 1.0E-32
sp|Q54HH2|SRR_DICDI Probable serine racemase OS=Dictyostelium discoideum GN=srr PE=3 SV=1 108 421 2.0E-32
sp|A0JNI4|SRR_BOVIN Serine racemase OS=Bos taurus GN=SRR PE=2 SV=1 111 427 5.0E-32
sp|Q76EQ0|SRR_RAT Serine racemase OS=Rattus norvegicus GN=Srr PE=1 SV=1 111 427 1.0E-27
sp|Q9QZX7|SRR_MOUSE Serine racemase OS=Mus musculus GN=Srr PE=1 SV=1 111 427 1.0E-26
sp|Q8R238|SDSL_MOUSE Serine dehydratase-like OS=Mus musculus GN=Sdsl PE=1 SV=1 123 415 2.0E-24
sp|Q8VBT2|SDHL_MOUSE L-serine dehydratase/L-threonine deaminase OS=Mus musculus GN=Sds PE=1 SV=3 125 431 1.0E-21
sp|P20132|SDHL_HUMAN L-serine dehydratase/L-threonine deaminase OS=Homo sapiens GN=SDS PE=1 SV=2 125 427 1.0E-18
sp|Q96GA7|SDSL_HUMAN Serine dehydratase-like OS=Homo sapiens GN=SDSL PE=1 SV=1 124 432 3.0E-18
sp|Q0VCW4|SDHL_BOVIN L-serine dehydratase/L-threonine deaminase OS=Bos taurus GN=SDS PE=2 SV=1 125 431 6.0E-18
sp|B5VKE8|SDHL_YEAS6 L-serine dehydratase OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SDL1 PE=3 SV=1 125 388 3.0E-16
sp|C8ZAU6|SDHL_YEAS8 L-serine dehydratase OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=SDL1 PE=3 SV=1 125 421 4.0E-16
sp|B3LU13|SDHL_YEAS1 L-serine dehydratase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SDL1 PE=3 SV=1 125 421 4.0E-16
sp|P09367|SDHL_RAT L-serine dehydratase/L-threonine deaminase OS=Rattus norvegicus GN=Sds PE=1 SV=3 125 432 6.0E-16
sp|P0CF23|SDH1_YEASX L-serine dehydratase OS=Saccharomyces cerevisiae GN=SDL1 PE=3 SV=1 125 421 8.0E-16
sp|A6ZVB1|SDHL_YEAS7 L-serine dehydratase OS=Saccharomyces cerevisiae (strain YJM789) GN=SDL1 PE=3 SV=1 125 421 2.0E-15
sp|P25379|STDH_YEAST Catabolic L-serine/threonine dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHA1 PE=1 SV=2 142 383 5.0E-14
sp|Q86B06|SDHL_DICDI L-serine dehydratase OS=Dictyostelium discoideum GN=sds PE=3 SV=1 141 415 1.0E-12
sp|Q8TQD4|THRC_METAC Threonine synthase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=thrC PE=1 SV=1 125 413 2.0E-09
sp|P0CF22|YI167_YEAST Putative truncated L-serine dehydratase SDL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDL1 PE=5 SV=1 238 421 1.0E-08
sp|Q9K7E3|THRC_BACHD Threonine synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=thrC PE=3 SV=1 125 413 6.0E-08
sp|Q58860|THRC_METJA Threonine synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=thrC PE=3 SV=1 104 413 1.0E-07
sp|B5ZNC1|SDHD_RHILW Probable D-serine dehydratase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dsdA PE=3 SV=1 175 390 6.0E-07
sp|P09123|THRC_BACSL Threonine synthase OS=Bacillus sp. (strain ULM1) GN=thrC PE=3 SV=1 125 413 7.0E-07
sp|B3PYT5|SDHD_RHIE6 Probable D-serine dehydratase OS=Rhizobium etli (strain CIAT 652) GN=dsdA PE=3 SV=1 175 390 1.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1025
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1459
Ophiocordyceps australis map64 (Brazil) OphauB2|7875
Ophiocordyceps camponoti-floridani Ophcf2|01046
Ophiocordyceps camponoti-rufipedis Ophun1|3856 (this protein)
Ophiocordyceps kimflemingae Ophio5|2741
Ophiocordyceps subramaniannii Hirsu2|929

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3856
MPSLNGSLPNGGPFHDGPSPGGPLFGSPAHGDAAHSGPPLSETTDRLENGHVFAPPSSVDSSRLQMSSGQMALTE
YSAKPSPPSDSPPNFASVVPPDLLLPSGYPDYLRLIASATSRVYEACRVTPLTPAVNLSNRLECTVLLKREDTQP
VFSFKLRGAYNKMAHLDPALSWRGVVCCSAGNHAQGVAYSARKLKIPATIIMPEGTPSIKHTNVARLGGHVVLHG
ADFDAAKEECARREKQDGLINIPPFDDPYVIAGQGTIGNELFGQVNMSKVEAVFCCCGGGGLIAGIGLYIKRMAP
QVKVIGVEARDANAMAQSLAKGQRVVLDNVGLFADGAAVKTLGEETFRIAREVVDHVVEVSTDEICAAIRDMYDD
TRSGLEPAGALSIAGLKKYVAQNPSSRPDRTLIAVTSGANMDFDRLRFVAERASLGEGKEVLLAVTIPERPGAFA
RLVDNVVPHAVTEFSYRFKSGAQANVLIGLSLTAPAAQREDELRSLLQRIRSEDMMVTDLSGDELAKSHVRYLVG
GQPNVPNERLFQFSFPERPRALEKFLMALRPKFNITLFHYRNYGGNIGKVLAGISCPEDETDVLAQFLVDVGYPV
EECTDSDVYRTFLRAEPERA*
Coding >Ophun1|3856
ATGCCCTCACTCAATGGGTCGCTCCCAAACGGCGGCCCTTTCCATGACGGTCCTTCCCCCGGCGGTCCTCTCTTC
GGCAGCCCTGCCCATGGTGACGCTGCCCATTCGGGACCTCCCCTGTCCGAGACGACGGATCGTCTCGAGAACGGC
CATGTCTTCGCCCCTCCGTCATCCGTCGACTCGTCCCGACTGCAAATGTCGAGCGGTCAGATGGCCCTGACCGAG
TATAGCGCCAAGCCGTCGCCGCCATCGGACTCTCCTCCGAACTTTGCGAGCGTCGTGCCCCCAGATCTGCTGCTC
CCCAGCGGTTACCCAGATTATCTTCGACTCATCGCCAGCGCTACCTCGCGAGTCTACGAGGCTTGCCGCGTTACG
CCGCTGACGCCAGCCGTCAACCTCAGCAACCGTCTCGAGTGCACCGTCTTACTCAAGCGCGAAGACACGCAACCC
GTCTTCAGCTTCAAGCTACGCGGCGCCTACAACAAGATGGCGCACCTCGACCCCGCCCTCAGCTGGCGAGGCGTC
GTCTGCTGCTCGGCCGGCAACCACGCGCAAGGCGTGGCCTATTCGGCGCGGAAGCTCAAGATCCCGGCCACCATC
ATCATGCCCGAGGGCACACCCAGCATTAAGCACACCAACGTGGCTCGCCTGGGCGGTCATGTCGTCTTACACGGC
GCCGACTTTGATGCTGCCAAGGAGGAGTGCGCGCGTCGCGAGAAGCAGGACGGGCTCATCAATATCCCGCCGTTT
GATGACCCCTACGTCATTGCCGGCCAGGGCACCATTGGCAACGAGCTCTTCGGCCAGGTTAACATGTCCAAGGTC
GAGGCCGTCTTTTGCTGCTGCGGCGGCGGCGGCCTCATCGCCGGCATCGGCCTCTACATCAAGCGCATGGCACCC
CAAGTCAAGGTCATCGGCGTCGAGGCCCGCGACGCAAACGCCATGGCTCAGTCCCTCGCCAAGGGTCAGAGGGTG
GTGCTCGACAATGTCGGCCTCTTCGCCGACGGCGCGGCCGTCAAGACGCTGGGCGAGGAGACGTTTCGAATCGCG
CGCGAAGTCGTCGATCATGTGGTTGAGGTCTCGACCGACGAGATCTGCGCCGCCATCCGTGACATGTACGACGAC
ACGCGCAGCGGTCTCGAGCCCGCCGGAGCCTTGTCCATTGCCGGTCTCAAGAAATACGTGGCACAGAACCCGTCT
TCGCGCCCGGATCGCACCCTCATCGCCGTCACGTCCGGCGCCAACATGGACTTTGATCGGCTGCGCTTCGTCGCC
GAGCGCGCGTCCTTGGGCGAAGGCAAGGAAGTCCTCCTGGCCGTGACCATCCCTGAGAGGCCCGGGGCCTTCGCC
CGGCTTGTCGACAACGTGGTGCCGCACGCCGTGACCGAGTTCTCGTACCGGTTCAAGTCGGGCGCGCAGGCCAAC
GTTCTCATCGGCCTGTCGCTCACGGCGCCGGCAGCCCAGCGCGAGGATGAGCTGCGCTCGCTGCTGCAACGCATC
CGGAGCGAGGACATGATGGTGACGGATCTGTCGGGCGACGAGCTCGCCAAGAGCCACGTGCGTTACCTGGTCGGT
GGCCAGCCCAACGTGCCCAACGAGAGGCTCTTCCAGTTCAGCTTCCCGGAGCGGCCCCGCGCACTTGAGAAGTTC
CTGATGGCGCTTCGGCCCAAGTTCAACATTACGCTCTTCCACTACCGCAACTACGGCGGCAACATTGGCAAGGTG
CTGGCTGGCATCTCGTGCCCGGAGGACGAGACGGATGTGCTTGCGCAGTTCCTGGTGGACGTGGGATACCCGGTG
GAGGAATGCACCGATTCGGACGTCTACCGGACCTTTTTACGTGCCGAACCGGAGCGGGCGTGA
Transcript >Ophun1|3856
ATGCCCTCACTCAATGGGTCGCTCCCAAACGGCGGCCCTTTCCATGACGGTCCTTCCCCCGGCGGTCCTCTCTTC
GGCAGCCCTGCCCATGGTGACGCTGCCCATTCGGGACCTCCCCTGTCCGAGACGACGGATCGTCTCGAGAACGGC
CATGTCTTCGCCCCTCCGTCATCCGTCGACTCGTCCCGACTGCAAATGTCGAGCGGTCAGATGGCCCTGACCGAG
TATAGCGCCAAGCCGTCGCCGCCATCGGACTCTCCTCCGAACTTTGCGAGCGTCGTGCCCCCAGATCTGCTGCTC
CCCAGCGGTTACCCAGATTATCTTCGACTCATCGCCAGCGCTACCTCGCGAGTCTACGAGGCTTGCCGCGTTACG
CCGCTGACGCCAGCCGTCAACCTCAGCAACCGTCTCGAGTGCACCGTCTTACTCAAGCGCGAAGACACGCAACCC
GTCTTCAGCTTCAAGCTACGCGGCGCCTACAACAAGATGGCGCACCTCGACCCCGCCCTCAGCTGGCGAGGCGTC
GTCTGCTGCTCGGCCGGCAACCACGCGCAAGGCGTGGCCTATTCGGCGCGGAAGCTCAAGATCCCGGCCACCATC
ATCATGCCCGAGGGCACACCCAGCATTAAGCACACCAACGTGGCTCGCCTGGGCGGTCATGTCGTCTTACACGGC
GCCGACTTTGATGCTGCCAAGGAGGAGTGCGCGCGTCGCGAGAAGCAGGACGGGCTCATCAATATCCCGCCGTTT
GATGACCCCTACGTCATTGCCGGCCAGGGCACCATTGGCAACGAGCTCTTCGGCCAGGTTAACATGTCCAAGGTC
GAGGCCGTCTTTTGCTGCTGCGGCGGCGGCGGCCTCATCGCCGGCATCGGCCTCTACATCAAGCGCATGGCACCC
CAAGTCAAGGTCATCGGCGTCGAGGCCCGCGACGCAAACGCCATGGCTCAGTCCCTCGCCAAGGGTCAGAGGGTG
GTGCTCGACAATGTCGGCCTCTTCGCCGACGGCGCGGCCGTCAAGACGCTGGGCGAGGAGACGTTTCGAATCGCG
CGCGAAGTCGTCGATCATGTGGTTGAGGTCTCGACCGACGAGATCTGCGCCGCCATCCGTGACATGTACGACGAC
ACGCGCAGCGGTCTCGAGCCCGCCGGAGCCTTGTCCATTGCCGGTCTCAAGAAATACGTGGCACAGAACCCGTCT
TCGCGCCCGGATCGCACCCTCATCGCCGTCACGTCCGGCGCCAACATGGACTTTGATCGGCTGCGCTTCGTCGCC
GAGCGCGCGTCCTTGGGCGAAGGCAAGGAAGTCCTCCTGGCCGTGACCATCCCTGAGAGGCCCGGGGCCTTCGCC
CGGCTTGTCGACAACGTGGTGCCGCACGCCGTGACCGAGTTCTCGTACCGGTTCAAGTCGGGCGCGCAGGCCAAC
GTTCTCATCGGCCTGTCGCTCACGGCGCCGGCAGCCCAGCGCGAGGATGAGCTGCGCTCGCTGCTGCAACGCATC
CGGAGCGAGGACATGATGGTGACGGATCTGTCGGGCGACGAGCTCGCCAAGAGCCACGTGCGTTACCTGGTCGGT
GGCCAGCCCAACGTGCCCAACGAGAGGCTCTTCCAGTTCAGCTTCCCGGAGCGGCCCCGCGCACTTGAGAAGTTC
CTGATGGCGCTTCGGCCCAAGTTCAACATTACGCTCTTCCACTACCGCAACTACGGCGGCAACATTGGCAAGGTG
CTGGCTGGCATCTCGTGCCCGGAGGACGAGACGGATGTGCTTGCGCAGTTCCTGGTGGACGTGGGATACCCGGTG
GAGGAATGCACCGATTCGGACGTCTACCGGACCTTTTTACGTGCCGAACCGGAGCGGGCGTGA
Gene >Ophun1|3856
ATGCCCTCACTCAATGGGTCGCTCCCAAACGGCGGCCCTTTCCATGACGGTCCTTCCCCCGGCGGTCCTCTCTTC
GGCAGCCCTGCCCATGGTGACGCTGCCCATTCGGGACCTCCCCTGTCCGAGACGACGGATCGTCTCGAGAACGGC
CATGTCTTCGCCCCTCCGTCATCCGTCGACTCGTCCCGACTGCAAATGTCGAGCGGTCAGATGGCCCTGACCGAG
TATAGCGCCAAGCCGTCGCCGCCATCGGACTCTCCTCCGAACTTTGCGAGCGTCGTGCCCCCAGATCTGCTGCTC
CCCAGCGGTTACCCAGATGTACGTCGACGACATGTTGGTGTTTTCACTGCGAAGCTTACACGGGAGCAATGACAG
TATCTTCGACTCATCGCCAGCGCTACCTCGCGAGTCTACGAGGCTTGCCGCGTTACGCCGCTGACGCCAGCCGTC
AACCTCAGCAACCGTCTCGAGTGCACCGTCTTACTCAAGCGCGAAGACACGCAACCCGTCTTCAGCTTCAAGCTA
CGCGGCGCCTACAACAAGATGGCGCACCTCGACCCCGCCCTCAGCTGGCGAGGCGTCGTCTGCTGCTCGGCCGGC
AACCACGCGCAAGGCGTGGCCTATTCGGCGCGGAAGCTCAAGATCCCGGCCACCATCATCATGCCCGAGGGCACA
CCCAGCATTAAGCACACCAACGTGGCTCGCCTGGGCGGTCATGTCGTCTTACACGGCGCCGACTTTGATGCTGCC
AAGGAGGAGTGCGCGCGTCGCGAGAAGCAGGACGGGCTCATCAATATCCCGCCGTTTGATGACCCCTACGTCATT
GCCGGCCAGGGCACCATTGGCAACGAGCTCTTCGGCCAGGTTAACATGTCCAAGGTCGAGGCCGTCTTTTGCTGC
TGCGGCGGCGGCGGCCTCATCGCCGGCATCGGCCTCTACATCAAGCGCATGGCACCCCAAGTCAAGGTCATCGGC
GTCGAGGCCCGCGACGCAAACGCCATGGCTCAGTCCCTCGCCAAGGGTCAGAGGGTGGTGCTCGACAATGTCGGC
CTCTTCGCCGACGGCGCGGCCGTCAAGACGCTGGGCGAGGAGACGTTTCGAATCGCGCGCGAAGTCGTCGATCAT
GTGGTTGAGGTCTCGACCGACGAGATCTGCGCCGCCATCCGTGACATGTACGACGACACGCGCAGCGGTCTCGAG
CCCGCCGGAGCCTTGTCCATTGCCGGTCTCAAGAAATACGTGGCACAGAACCCGTCTTCGCGCCCGGATCGCACC
CTCATCGCCGTCACGTCCGGCGCCAACATGGACTTTGATCGGCTGCGCTTCGTCGCCGAGCGCGCGTCCTTGGGC
GAAGGCAAGGAAGTCCTCCTGGCCGTGACCATCCCTGAGAGGCCCGGGGCCTTCGCCCGGCTTGTCGACAACGTG
GTGCCGCACGCCGTGACCGAGTTCTCGTACCGGTTCAAGTCGGGCGCGCAGGCCAACGTTCTCATCGGCCTGTCG
CTCACGGCGCCGGCAGCCCAGCGCGAGGATGAGCTGCGCTCGCTGCTGCAACGCATCCGGAGCGAGGACATGATG
GTGACGGATCTGTCGGGCGACGAGCTCGCCAAGAGCCACGTGCGTTACCTGGTCGGTGGCCAGCCCAACGTGCCC
AACGAGAGGCTCTTCCAGTTCAGCTTCCCGGAGCGGCCCCGCGCACTTGAGAAGTTCCTGATGGCGCTTCGGCCC
AAGTTCAACATTACGCTCTTCCACTACCGCAACTACGGCGGCAACATTGGCAAGGTGCTGGCTGGCATCTCGTGC
CCGGAGGACGAGACGGATGTGCTTGCGCAGTTCCTGGTGGACGTGGGATACCCGGTGGAGGAATGCACCGATTCG
GACGTCTACCGGACCTTTTTACGTGCCGAACCGGAGCGGGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail