Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3841
Gene name
LocationContig_346:7043..16746
Strand-
Gene length (bp)9703
Transcript length (bp)9645
Coding sequence length (bp)9645
Protein length (aa) 3215

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20413 Kiaa1109_N Kiaa1109 N-terminal region 4.5E-286 39 1070

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12150|CSF1_YEAST Protein CSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSF1 PE=3 SV=1 15 1153 8.0E-107
sp|Q74ZX0|CSF1_ASHGO Protein CSF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSF1 PE=3 SV=1 32 1154 2.0E-75
sp|Q74ZX0|CSF1_ASHGO Protein CSF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSF1 PE=3 SV=1 2271 3212 8.0E-64
sp|Q12150|CSF1_YEAST Protein CSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSF1 PE=3 SV=1 2464 3211 4.0E-62
sp|A2AAE1|K1109_MOUSE Uncharacterized protein KIAA1109 OS=Mus musculus GN=Kiaa1109 PE=1 SV=4 407 753 7.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12150|CSF1_YEAST Protein CSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSF1 PE=3 SV=1 15 1153 8.0E-107
sp|Q74ZX0|CSF1_ASHGO Protein CSF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSF1 PE=3 SV=1 32 1154 2.0E-75
sp|Q74ZX0|CSF1_ASHGO Protein CSF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSF1 PE=3 SV=1 2271 3212 8.0E-64
sp|Q12150|CSF1_YEAST Protein CSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSF1 PE=3 SV=1 2464 3211 4.0E-62
sp|A2AAE1|K1109_MOUSE Uncharacterized protein KIAA1109 OS=Mus musculus GN=Kiaa1109 PE=1 SV=4 407 753 7.0E-20
sp|Q2LD37|K1109_HUMAN Uncharacterized protein KIAA1109 OS=Homo sapiens GN=KIAA1109 PE=1 SV=2 446 753 6.0E-19
sp|Q12150|CSF1_YEAST Protein CSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSF1 PE=3 SV=1 1261 1638 1.0E-09
sp|Q74ZX0|CSF1_ASHGO Protein CSF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSF1 PE=3 SV=1 1258 1637 3.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 21 40 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3841
MSLVDDVIVARSPERPEYRAVLPVLYIIAALLVIFFLLYFNRVFASIVSYGIRAFTWNQYRIFIDFKALQISLLA
GRIFFTGLRYHGSNETLLVQHGTITWRYWLRRVRDVDVQASSCSGEDAGSKQARNAALPCRINVNVVGVEIFIYN
RSPAYDTILSGIVGSGSSGGASTGVFVGQDEGTVRPRKSDSNQEDKDDSGAKTEKSRDSTSARSGSDAPHRGPIG
GKREEAQLPFILQLLPIHVDCQKAAIVIGNDTTKAILTAKANSAAIDIDASPTHTCDPYRQIAKVTVERPKIETR
DNEGFKEDQIARATRRQEDERQAEPPLHKAFLRRTRRRLLDPLRKIVPWWRRSVEPFSAESKSAGATRAAQVPGA
AQWQGLSRYLDEQDQDDKARWTSVEYGAVPTIVDSPQVTITLFWDVPGRVTEQAHLNGATSSPPDVNGSEPPAWG
MSLSVKGGTVNYGPWTDRQRFALQSMFFPTISKDATPATPLPVGAWRVPTQFTLFIEIEEAATLRIITREESKNW
RWRGKEPATLHKKGPSKRMQWNRAKKNSKGDASHPRPAGWMEIKLPTNSTVSFTTDMLASTSGYKTNVNIDLPSA
ELSTSVNHDLLYRCGAQRITCNMPMPLSWNSLRIWHVTVDSDDLDLFLLRDHVFLLADLIADWGAGAMPEYLQFV
PFEYYLHLNFRNARLIINVNEQNIIDKATAPDDNTYMMLSSPRVNVTVHIPIDKFQPDKTAVSFDVRADTPNLVV
NVPQSSTQAAILPCTDLGVADGLVVSGSFNFNSTVAPGLTDTIVLKVHVQAPHVRIYGFIMRYIVLLRDNIFAEY
MHFKTLGEYLELKKQGADTVTPPSNTGMNELDLILAVRVDDPRALIAANVYCGGERCIQADLADLSLDLRLNSYI
MDMEVSLSPVSLSLGRPMEDAESVSASSSDTQVFADGLRIFCHRTFGLPGNEQAYLTNWDVGLGAISGECTAEFL
ATLVGLGLSFLFTFDDAENALIPYSMLVFPDLVFARIAVDSFHVWVHIDEAAFLVSTDKIELISNDWARSHYSKR
TNIVIPNLQLCCVNAEAATARHTSRRHHAANTEAYLQTDIQIAMVGRKFHFSAERKSQQDLIRREDQRTERTQFL
LLGDPDPDFVPDTFEPPAQPSPMPPVPITEADVSLRSPGGSSHFDRNRGPGRQSSSLSLSSSYESRLNGESRTKL
KDKRGVFGSTGRRTASGRRLDAAYEWRRSTSRDPAGLFPFKDNLDHMSVAFSSQYFAPHFPLESVRADTREAEYP
EVPDESYDDGFWQTEASLDEIDPSSLSEEHSHESTIIEFPSGISAFFRPEALRHAISLLAELQPKDPESILDFLQ
VGAINEVFAAQKPEYDQGTIQEISVRIPSAEIRVLNDATAHSYDDSCEEQDQYDVRLTKLALVSRTVTEKGEAEK
MVTSANPRTSLHFRLKSAEVCVSERSAPPSNPQEALMLEIDTVILSLGTKDVTYFDADVGSVVGSTASGKIDYIV
SLIHRTSSLATDLERIITDTTASYGNRARYLAYHLLSEGSSTKDPSFFTRPSAVLRSAPTHLRRTDTWKLIMRLR
QIWATMGNRRRSQLAAACHDGSLAVPPDALNTITAAFERWRSWDLEDTANSVLVKHLFDGEKDGADVKAGRDFPL
IGACRLGELRFVLDPGPRQNNVAFIDVAVRVEQKPADSSDTVPEMAGFNGPLTVCNISCSEAEIHLNWGLCELAE
DLLRLYNQSLASTLGNFESHDAEVSKSPLPAFHIAFELSRGSIDLETINLSLKTLSCGLKGSILVYSIGDKTDFA
SCLLNCNTITSRLHSGSQLLSVFQLRQPSVFVSHELQETQDASLRTIKSTASSQGLKLAVKQDPIALLEVIGLLV
KDEAAQLSRLHAQFTSSPPPPKPVKISDRLSKVRINVALFLESYTISVSLLQSLTWKISGVVARMACAANNGKEV
IFDFDVKENSHEMQIKMGDEPRSISLLQIPPMNGRIRGHAGEQSGHSLSVLSSIEVIRLDASAIYSLLAVLNRPQ
ISNAVDDMQQQIKVVQEHIEDVFGGSRPPPPIEPAPPRPLLAYDVHVTLAGLRILAKTSLTSKSEPMAQIYFSLD
KTSLLACNQRDPQEPALKYPDLHLNLLHVGLDIRRGSKDASRCCGSIGTSATVSASSRRGDDGREDWNLNFRSNV
LDVNLSPETVSTVIDVVGYLGTKIKDLDTSRELEYLRKLRQPKSRAAADDQEKPGDEADIIDSVLASVVCQFELR
NIRVCWNVADKSTEKDSGKEDMVLSVELIEFGTRTRKSARLTISSILVQSVPPGHDKSVRSLHSALLPSVIFNAA
YTSTAGTRRMAFQATGESLDLRLTSGFIVPAASLVKSISLSFRNVQKASAQWTTDSTVAPKKAGESSPESEQQQQ
HWSFLDNKRLESLLVDADFAGAVVYVSSKNAAGSSQSADQSWRPALDGKYGQFKTDDLGSAVVLRSPGVAGKAEY
RDSGGDDPTLYGEVKIDASSNTLHPSVVPLVMDIVSSVKEVVSDDGSQDKGDEEDEPPKLKPERSADEDNILTAD
PSAVLGRVKLNLGLRICRQAFTLSCQPVGRVEATACFDNVYFTVNTVHSLEQGNFFAISGTLSQPQASVQHVYSR
QSTASFGVDTVTVSFMNSKHVSGTNGVSVILKVSPMKASINAKQAQDFLLFREIWHPDNPRHAAARGPVAKLETE
TSQGYLVQRYQQVAATAAFPWTATISIAALDVHVDLGQAIGKSVFQISDFWVSSKKTSDWEQNLCLGFQRIGIDC
TGRLSGFIALQSFRLRTSIQWPKREEALNKTPLIHASLAFNACRAKAAFDYQAFLVADITSLDFLMYNVREKRDG
SGDRLVAMLDGEAVQVFGTTASAAQGLRLFQAIQKLVQEKKESFESSLREIDKFTRRKAARTSDQPAASSSDVVA
AKSPISLDTHVVVTFKALNLGVFPATFSDHQVFKVEALNAHARFSASLVQRRIHSVLRMTLGQLRIGLAGMRNVE
APKPLSEVTVEDVVARVTGSRGGTILNVPRVEAMMETWQRPDSNLISYIFKSALEGKVEVGWNYSRISYIRGMWA
KHTKALEQIWGRQLPMTAVKITGVPEAEAEAEVEASAAQGEPEVGSKDKDGAAGPREGGQQKITAEVKVPQSKYE
YEALEPPIIDTPQLRDMGEATPPLEWIGLHRDKLPNLTHQMVIVSLLELAGEVEDAYSRILGSS*
Coding >Ophun1|3841
ATGTCCCTTGTCGACGACGTGATCGTGGCCCGATCGCCAGAGCGTCCCGAGTACAGGGCCGTGCTCCCGGTCTTG
TACATCATCGCCGCGCTGCTCGTCATCTTCTTTCTTCTCTACTTTAATCGAGTCTTTGCCTCCATCGTCTCGTAC
GGCATCAGGGCCTTTACCTGGAATCAGTACCGAATCTTCATCGACTTCAAGGCTTTGCAGATATCCCTCCTCGCC
GGCCGCATCTTCTTTACCGGCCTGCGCTACCACGGCTCCAACGAGACTCTACTGGTGCAGCACGGCACTATAACA
TGGCGGTACTGGCTGCGTCGAGTACGAGACGTCGACGTCCAGGCGTCCAGCTGCTCGGGCGAGGATGCCGGCTCC
AAGCAGGCCAGGAATGCCGCCCTTCCCTGTCGCATCAACGTCAACGTCGTCGGCGTCGAGATCTTCATCTACAAC
CGCAGTCCCGCTTACGACACTATTCTCTCCGGAATCGTCGGCAGCGGCTCTTCTGGCGGAGCTTCCACCGGCGTC
TTCGTCGGCCAGGACGAGGGCACCGTCAGGCCGAGAAAGTCGGACTCGAACCAGGAGGACAAGGATGACTCAGGG
GCAAAGACGGAAAAGTCTCGAGACTCTACCTCGGCTCGTTCCGGCTCAGATGCACCTCACAGAGGTCCTATCGGC
GGAAAACGAGAGGAAGCACAACTCCCATTCATCCTCCAACTACTTCCCATCCACGTCGACTGTCAAAAAGCCGCC
ATAGTCATAGGCAATGACACGACCAAGGCCATCCTCACGGCAAAGGCCAACTCGGCGGCCATCGATATAGACGCC
TCGCCCACTCATACGTGCGATCCATACCGACAGATCGCCAAAGTGACGGTTGAACGGCCCAAGATCGAGACGAGG
GACAACGAGGGCTTCAAGGAAGATCAGATTGCTCGCGCCACCAGGCGCCAGGAAGATGAGCGACAGGCAGAACCA
CCTCTGCACAAGGCCTTTCTACGACGCACCCGTCGTCGGCTCCTCGACCCCCTGCGGAAAATCGTTCCCTGGTGG
CGACGGTCTGTCGAGCCCTTCTCGGCCGAATCGAAATCAGCCGGGGCAACGAGAGCGGCCCAGGTCCCGGGAGCG
GCCCAATGGCAAGGCCTCTCCCGATATCTGGACGAACAAGACCAAGACGACAAAGCACGGTGGACGTCGGTAGAA
TACGGTGCAGTCCCGACCATCGTGGACTCGCCTCAGGTGACCATCACTCTCTTCTGGGATGTTCCGGGTCGCGTG
ACAGAGCAGGCTCACTTGAACGGTGCTACGAGTTCGCCACCCGATGTCAACGGCAGCGAGCCGCCTGCTTGGGGC
ATGAGTCTCTCCGTCAAAGGAGGCACCGTCAACTACGGCCCTTGGACAGACCGGCAGCGGTTCGCTCTACAGAGC
ATGTTCTTCCCGACAATCTCCAAAGACGCCACTCCCGCGACACCGTTGCCCGTCGGCGCCTGGCGAGTTCCCACC
CAGTTCACGCTGTTTATCGAGATCGAGGAAGCGGCTACTCTGCGCATCATCACGCGAGAGGAGTCCAAGAACTGG
CGTTGGCGCGGAAAGGAACCGGCCACGCTTCACAAAAAGGGGCCCAGCAAGCGCATGCAATGGAACCGGGCCAAG
AAGAACTCCAAGGGGGATGCATCTCATCCGAGGCCTGCCGGCTGGATGGAGATTAAGCTGCCGACAAACTCGACC
GTATCCTTCACGACGGACATGCTCGCCAGCACTTCGGGATACAAGACGAATGTCAACATTGACCTCCCCAGCGCA
GAGCTCAGTACCAGCGTCAATCACGACTTGCTCTACCGATGCGGAGCCCAGCGCATTACCTGCAATATGCCCATG
CCCCTGTCGTGGAACTCGCTCCGTATCTGGCATGTCACCGTCGACAGCGACGATCTGGACTTGTTTCTCCTTCGC
GATCACGTCTTCCTCCTGGCCGACCTCATCGCCGACTGGGGCGCCGGAGCCATGCCCGAGTATCTACAGTTTGTG
CCCTTTGAGTACTATCTGCACCTCAACTTCCGTAACGCGAGGCTCATCATCAACGTCAACGAACAAAACATCATT
GACAAAGCCACGGCCCCTGACGACAACACTTACATGATGCTTTCCAGTCCTCGCGTCAACGTCACCGTCCACATA
CCCATCGACAAGTTTCAGCCAGACAAGACGGCGGTTTCGTTTGACGTGAGGGCCGACACTCCCAACCTGGTCGTC
AACGTCCCTCAGTCGAGCACACAGGCCGCCATTCTGCCATGCACTGATCTGGGCGTTGCTGACGGCCTCGTCGTG
TCTGGGAGCTTCAATTTCAACTCGACCGTCGCCCCCGGGCTCACCGACACAATCGTCCTCAAGGTCCACGTCCAG
GCACCACACGTGCGCATCTACGGCTTCATCATGCGCTACATCGTGCTGCTGAGGGACAACATCTTTGCGGAATAC
ATGCACTTCAAGACGCTGGGCGAGTATCTGGAGTTGAAGAAACAGGGCGCCGACACGGTGACACCTCCCTCAAAC
ACGGGCATGAACGAGCTCGATCTCATCCTGGCTGTCAGGGTTGACGATCCCCGGGCCTTGATCGCGGCCAACGTC
TACTGCGGCGGCGAGCGCTGCATACAGGCCGATCTTGCTGACCTGTCACTCGATCTTCGCCTCAACAGCTACATC
ATGGACATGGAGGTTTCTCTGAGCCCAGTGAGTCTCTCGTTGGGCCGTCCGATGGAGGATGCCGAGTCTGTGAGC
GCCTCGTCGTCCGACACCCAAGTCTTCGCCGACGGGCTGCGCATCTTTTGCCATCGGACCTTTGGCCTGCCCGGT
AACGAGCAGGCCTATCTCACCAACTGGGACGTTGGCCTCGGGGCCATCAGCGGCGAATGCACGGCCGAGTTCCTC
GCTACCCTGGTCGGACTCGGCCTGTCGTTTCTCTTCACCTTTGACGACGCGGAGAACGCGCTGATACCGTATTCG
ATGCTTGTGTTTCCCGATCTCGTCTTCGCCCGTATAGCCGTCGATTCGTTCCATGTATGGGTTCACATCGATGAG
GCCGCTTTTCTCGTCTCGACAGACAAGATCGAACTCATCAGCAACGACTGGGCCCGCTCGCACTACTCCAAGCGC
ACCAACATCGTGATCCCCAATCTGCAGCTGTGTTGCGTCAATGCCGAGGCTGCTACCGCCAGACACACGTCTCGA
CGTCACCACGCGGCTAATACCGAGGCCTACTTGCAGACCGACATTCAGATCGCCATGGTCGGTCGAAAGTTTCAC
TTCTCCGCCGAGCGGAAATCACAGCAGGACTTGATCCGTCGCGAGGATCAGCGCACGGAGAGAACTCAGTTTCTT
CTCCTCGGCGACCCGGACCCTGATTTTGTACCGGATACCTTCGAGCCCCCGGCCCAACCATCTCCCATGCCGCCT
GTTCCCATCACCGAGGCCGACGTTAGTCTTCGTTCGCCTGGTGGTTCTTCGCACTTTGATCGCAATCGGGGCCCG
GGCCGTCAAAGCTCGTCACTTTCTCTATCCAGCAGCTACGAATCCAGACTCAACGGCGAGTCTCGCACGAAGCTG
AAAGACAAAAGAGGCGTCTTTGGCTCTACCGGGCGAAGAACGGCTTCGGGTCGGAGACTGGATGCCGCGTACGAG
TGGCGACGATCTACTTCTCGCGATCCTGCGGGTCTGTTTCCTTTCAAAGATAACCTTGACCATATGTCCGTTGCC
TTCTCGAGTCAATACTTCGCGCCTCATTTTCCTCTGGAGAGTGTCCGCGCAGACACGCGTGAGGCCGAGTATCCT
GAAGTCCCTGATGAGAGCTACGACGATGGTTTCTGGCAAACGGAAGCTTCTTTGGATGAGATTGATCCGTCCAGT
CTCAGTGAGGAGCACTCTCACGAAAGCACCATCATCGAGTTTCCCTCTGGCATTTCGGCATTTTTCAGGCCCGAG
GCGCTGCGACATGCCATCTCTCTCCTTGCTGAACTACAGCCCAAAGACCCGGAGAGCATCCTCGACTTTCTCCAG
GTTGGAGCCATCAACGAGGTGTTCGCCGCTCAGAAGCCGGAGTATGACCAGGGGACGATCCAGGAGATTAGCGTG
AGGATTCCAAGCGCGGAAATCCGAGTCCTCAACGACGCGACAGCTCATTCTTACGACGACTCGTGCGAAGAGCAA
GACCAATACGATGTGCGGCTCACGAAGCTTGCTCTGGTCAGTCGAACAGTCACAGAAAAGGGAGAGGCTGAGAAG
ATGGTCACCTCGGCGAACCCGAGGACATCGCTCCATTTTCGACTCAAGTCGGCAGAAGTCTGCGTGTCAGAGCGT
TCTGCGCCGCCGTCCAATCCTCAAGAAGCCCTTATGCTGGAGATTGACACCGTCATTCTGTCCCTGGGCACGAAA
GACGTCACTTACTTTGATGCTGATGTGGGCTCCGTGGTTGGAAGCACTGCTTCCGGCAAGATCGACTATATAGTC
TCTCTCATCCATCGGACCAGTAGCCTGGCTACAGATCTGGAGCGTATCATCACCGACACCACTGCCAGCTACGGC
AACCGAGCCCGGTATCTTGCTTATCATCTCTTGAGCGAGGGCTCGTCTACGAAAGATCCCTCGTTCTTTACGCGG
CCGTCTGCTGTTCTGAGATCGGCACCAACACACCTGCGGAGGACCGATACTTGGAAGCTGATCATGCGTCTTCGT
CAGATCTGGGCTACCATGGGAAACCGGAGGCGCTCTCAGCTGGCGGCAGCGTGTCATGACGGCTCCCTCGCGGTT
CCTCCCGATGCTCTCAATACTATAACTGCCGCATTTGAAAGGTGGCGCAGCTGGGACCTGGAAGATACCGCAAAC
TCTGTACTCGTCAAGCACCTTTTCGACGGAGAAAAGGACGGTGCAGATGTCAAGGCCGGACGCGACTTTCCTCTC
ATCGGGGCTTGCCGCCTTGGAGAGCTGCGGTTCGTCTTGGATCCGGGACCCAGACAGAATAATGTCGCCTTCATT
GATGTGGCCGTCCGGGTTGAGCAGAAGCCGGCCGACTCGAGCGATACCGTGCCGGAGATGGCCGGATTCAACGGC
CCCTTGACGGTCTGCAACATCAGCTGCAGCGAGGCTGAAATCCATCTCAACTGGGGGCTTTGCGAGTTGGCAGAA
GACCTTCTACGGCTATACAACCAAAGCCTCGCGAGCACCCTTGGCAATTTCGAATCCCACGACGCAGAGGTTTCG
AAATCGCCTCTACCGGCCTTCCACATCGCTTTCGAGCTTTCGAGGGGCTCCATCGACCTGGAGACTATCAACCTC
AGCTTGAAGACGTTGAGCTGTGGACTCAAGGGTTCCATCTTGGTGTACAGCATCGGTGACAAGACGGACTTTGCG
AGCTGCCTGCTCAACTGCAACACCATTACGTCGCGTCTGCATAGCGGTTCTCAGCTCCTGAGCGTCTTCCAGCTT
CGTCAGCCAAGCGTCTTTGTGTCCCACGAGCTGCAAGAGACGCAGGATGCCTCGCTGCGGACCATTAAATCAACC
GCTAGCAGCCAGGGGCTGAAGCTCGCTGTCAAACAGGACCCCATTGCTCTACTGGAAGTCATCGGCCTCCTCGTC
AAGGACGAAGCCGCGCAGCTCAGCCGTCTTCACGCTCAGTTTACGAGCTCACCTCCCCCGCCGAAGCCCGTCAAG
ATCTCAGACCGTCTGTCCAAGGTTCGGATCAATGTGGCCCTGTTTCTCGAGAGCTATACCATCAGTGTCTCGCTT
CTGCAGTCGCTCACCTGGAAGATTTCGGGCGTCGTGGCGCGAATGGCGTGTGCTGCGAACAATGGCAAGGAGGTC
ATCTTTGACTTTGACGTCAAGGAGAACTCGCACGAGATGCAGATCAAAATGGGGGATGAGCCTCGGAGCATCTCT
CTTCTTCAGATTCCTCCCATGAATGGTCGCATCAGGGGTCATGCGGGAGAACAGTCGGGGCATTCCTTGTCCGTG
CTCTCGTCTATCGAGGTCATTCGATTAGATGCTTCGGCCATTTACAGCTTGCTCGCCGTTCTCAACCGGCCGCAA
ATCTCCAACGCGGTTGACGACATGCAACAGCAGATCAAGGTCGTACAGGAGCACATCGAGGATGTCTTTGGAGGC
TCACGTCCGCCACCGCCCATCGAACCCGCTCCGCCTCGGCCGTTGCTGGCGTACGATGTTCACGTCACTCTCGCT
GGCCTGAGAATACTTGCCAAAACATCTCTGACATCCAAGAGCGAGCCGATGGCTCAGATCTACTTTTCGCTTGAC
AAGACATCCCTGCTTGCTTGCAACCAGCGTGATCCGCAGGAGCCCGCACTCAAGTATCCAGATCTGCACCTGAAC
CTGCTCCACGTCGGTCTCGACATCCGCAGGGGCTCAAAAGATGCCTCGAGATGCTGCGGCAGTATCGGGACAAGT
GCCACCGTCTCGGCGAGCTCACGGCGAGGGGATGACGGCAGGGAGGACTGGAATTTGAACTTTCGCAGCAATGTG
CTGGACGTTAATCTCTCTCCGGAGACGGTGTCTACGGTCATCGACGTGGTCGGATACCTGGGCACTAAGATTAAG
GATCTGGACACGTCTCGTGAACTCGAGTATCTAAGAAAGCTGAGGCAGCCCAAATCCCGAGCCGCCGCTGACGAC
CAGGAGAAGCCGGGAGACGAGGCAGACATCATCGACTCCGTGCTGGCGTCTGTCGTCTGTCAGTTCGAGCTGCGT
AACATCCGGGTGTGCTGGAATGTGGCGGACAAGTCGACAGAAAAGGACTCGGGCAAAGAAGACATGGTTCTGTCC
GTAGAGCTCATCGAGTTTGGGACCAGGACGAGGAAGTCGGCGAGGTTGACCATCTCCAGTATCTTGGTGCAGTCG
GTGCCACCTGGTCACGACAAGAGCGTGCGATCACTACACTCGGCGCTTCTTCCTTCGGTCATCTTTAACGCGGCA
TATACGTCGACGGCGGGAACCCGGCGGATGGCGTTTCAGGCCACGGGCGAGTCTCTCGACCTGCGGCTGACGTCT
GGCTTCATCGTGCCCGCTGCCAGCCTCGTCAAGTCTATTTCTCTGTCGTTCCGAAACGTGCAGAAGGCCTCAGCC
CAGTGGACGACGGACTCGACGGTGGCCCCGAAGAAGGCAGGCGAGTCATCTCCCGAGTCGGAGCAGCAGCAGCAG
CACTGGAGCTTCCTGGACAACAAGCGGCTTGAGAGCCTGCTCGTCGACGCCGACTTTGCAGGAGCCGTCGTGTAT
GTCTCCAGCAAGAATGCTGCTGGCAGCTCGCAGTCGGCGGATCAGAGCTGGCGGCCGGCTTTGGACGGCAAATAT
GGCCAGTTCAAAACGGATGACTTGGGGAGTGCAGTCGTTCTTCGCAGTCCGGGGGTTGCTGGCAAGGCTGAGTAC
AGAGACAGCGGCGGAGACGATCCCACGCTATACGGCGAGGTCAAGATCGACGCTTCCAGCAACACTCTGCACCCG
TCGGTGGTGCCCCTTGTCATGGACATCGTCTCGAGCGTCAAGGAGGTCGTCAGCGATGACGGCAGCCAGGACAAG
GGAGATGAGGAGGACGAGCCGCCCAAGCTGAAGCCGGAGCGGTCCGCGGATGAGGATAATATTCTCACGGCCGAT
CCGAGCGCCGTTTTGGGCCGAGTGAAGCTCAATCTCGGTCTTCGCATCTGCAGACAGGCATTCACCTTGAGCTGC
CAGCCGGTAGGACGCGTCGAGGCGACGGCCTGCTTCGACAATGTCTATTTTACCGTCAACACCGTCCACTCTCTC
GAGCAGGGCAACTTCTTCGCCATCTCGGGCACGCTGAGCCAGCCGCAGGCCTCGGTCCAGCACGTCTACTCGCGG
CAATCGACGGCCAGTTTCGGGGTTGATACGGTGACGGTGTCGTTTATGAATAGCAAGCACGTCAGCGGCACCAAC
GGCGTGTCGGTTATTCTCAAGGTGAGCCCGATGAAGGCGTCCATCAACGCGAAGCAGGCACAGGACTTCTTGCTT
TTCAGGGAGATCTGGCACCCGGACAATCCGCGTCATGCGGCAGCGAGGGGCCCCGTGGCCAAGCTCGAGACGGAG
ACGTCACAGGGGTATCTGGTGCAGCGATATCAGCAGGTGGCGGCTACGGCTGCCTTTCCCTGGACGGCCACGATC
TCTATCGCGGCGCTCGACGTCCATGTCGATCTGGGACAGGCCATTGGAAAGTCCGTCTTCCAGATCAGCGACTTC
TGGGTCTCGTCCAAGAAGACGTCCGACTGGGAGCAGAATCTCTGTCTGGGGTTCCAACGGATCGGCATTGATTGC
ACAGGCCGGCTGAGCGGCTTCATCGCCTTGCAGTCCTTCCGTCTACGGACATCGATCCAGTGGCCGAAGCGAGAA
GAGGCTCTCAACAAGACGCCACTGATACACGCGTCGTTGGCATTCAACGCCTGTCGTGCCAAGGCAGCCTTTGAT
TACCAGGCCTTCTTGGTTGCCGACATCACATCGCTCGACTTCCTCATGTACAATGTGCGGGAGAAGCGAGACGGA
AGCGGGGATCGACTGGTGGCCATGCTCGACGGCGAGGCGGTTCAAGTCTTCGGAACGACTGCGTCGGCAGCTCAG
GGCTTGAGGCTCTTTCAGGCCATCCAGAAGCTGGTGCAGGAGAAGAAGGAGAGCTTCGAGTCGTCTTTGCGGGAG
ATTGATAAGTTCACGAGACGCAAGGCGGCACGAACCTCGGATCAGCCAGCGGCGTCTTCGTCGGATGTGGTGGCG
GCCAAGTCGCCCATATCCCTGGACACGCATGTGGTGGTGACGTTCAAGGCGCTGAACCTCGGCGTCTTTCCCGCT
ACCTTTTCGGATCATCAGGTGTTCAAGGTGGAGGCGCTCAACGCTCACGCAAGGTTCTCTGCCAGCTTGGTACAA
CGACGGATCCATAGCGTGCTTCGCATGACGCTGGGCCAGCTACGGATCGGGCTGGCCGGGATGCGCAACGTCGAG
GCGCCCAAGCCGCTGAGCGAGGTGACGGTCGAGGACGTTGTGGCTCGGGTGACGGGTTCTCGCGGAGGGACCATT
CTCAATGTGCCGCGGGTAGAGGCCATGATGGAGACGTGGCAACGGCCAGACAGCAACCTCATCAGCTACATCTTC
AAGAGCGCGCTCGAGGGCAAAGTCGAAGTCGGCTGGAACTATTCGCGCATCAGCTACATCCGCGGCATGTGGGCC
AAGCACACCAAGGCGCTGGAGCAGATCTGGGGCCGACAGCTGCCCATGACGGCCGTCAAGATCACGGGTGTGCCG
GAGGCTGAGGCCGAGGCCGAGGTGGAGGCGAGTGCCGCACAAGGAGAGCCGGAAGTCGGAAGCAAAGACAAGGAC
GGCGCCGCGGGGCCGCGCGAGGGCGGACAGCAGAAGATCACGGCCGAGGTCAAGGTGCCGCAGTCCAAGTATGAG
TACGAAGCGCTGGAGCCGCCCATCATCGACACGCCGCAGCTGCGCGACATGGGAGAGGCGACGCCGCCGCTCGAG
TGGATAGGGCTGCACCGGGATAAGCTGCCCAACTTGACTCATCAGATGGTCATTGTGTCGCTGCTGGAGCTTGCC
GGAGAGGTGGAGGATGCATATTCGCGGATCCTGGGGTCGTCATGA
Transcript >Ophun1|3841
ATGTCCCTTGTCGACGACGTGATCGTGGCCCGATCGCCAGAGCGTCCCGAGTACAGGGCCGTGCTCCCGGTCTTG
TACATCATCGCCGCGCTGCTCGTCATCTTCTTTCTTCTCTACTTTAATCGAGTCTTTGCCTCCATCGTCTCGTAC
GGCATCAGGGCCTTTACCTGGAATCAGTACCGAATCTTCATCGACTTCAAGGCTTTGCAGATATCCCTCCTCGCC
GGCCGCATCTTCTTTACCGGCCTGCGCTACCACGGCTCCAACGAGACTCTACTGGTGCAGCACGGCACTATAACA
TGGCGGTACTGGCTGCGTCGAGTACGAGACGTCGACGTCCAGGCGTCCAGCTGCTCGGGCGAGGATGCCGGCTCC
AAGCAGGCCAGGAATGCCGCCCTTCCCTGTCGCATCAACGTCAACGTCGTCGGCGTCGAGATCTTCATCTACAAC
CGCAGTCCCGCTTACGACACTATTCTCTCCGGAATCGTCGGCAGCGGCTCTTCTGGCGGAGCTTCCACCGGCGTC
TTCGTCGGCCAGGACGAGGGCACCGTCAGGCCGAGAAAGTCGGACTCGAACCAGGAGGACAAGGATGACTCAGGG
GCAAAGACGGAAAAGTCTCGAGACTCTACCTCGGCTCGTTCCGGCTCAGATGCACCTCACAGAGGTCCTATCGGC
GGAAAACGAGAGGAAGCACAACTCCCATTCATCCTCCAACTACTTCCCATCCACGTCGACTGTCAAAAAGCCGCC
ATAGTCATAGGCAATGACACGACCAAGGCCATCCTCACGGCAAAGGCCAACTCGGCGGCCATCGATATAGACGCC
TCGCCCACTCATACGTGCGATCCATACCGACAGATCGCCAAAGTGACGGTTGAACGGCCCAAGATCGAGACGAGG
GACAACGAGGGCTTCAAGGAAGATCAGATTGCTCGCGCCACCAGGCGCCAGGAAGATGAGCGACAGGCAGAACCA
CCTCTGCACAAGGCCTTTCTACGACGCACCCGTCGTCGGCTCCTCGACCCCCTGCGGAAAATCGTTCCCTGGTGG
CGACGGTCTGTCGAGCCCTTCTCGGCCGAATCGAAATCAGCCGGGGCAACGAGAGCGGCCCAGGTCCCGGGAGCG
GCCCAATGGCAAGGCCTCTCCCGATATCTGGACGAACAAGACCAAGACGACAAAGCACGGTGGACGTCGGTAGAA
TACGGTGCAGTCCCGACCATCGTGGACTCGCCTCAGGTGACCATCACTCTCTTCTGGGATGTTCCGGGTCGCGTG
ACAGAGCAGGCTCACTTGAACGGTGCTACGAGTTCGCCACCCGATGTCAACGGCAGCGAGCCGCCTGCTTGGGGC
ATGAGTCTCTCCGTCAAAGGAGGCACCGTCAACTACGGCCCTTGGACAGACCGGCAGCGGTTCGCTCTACAGAGC
ATGTTCTTCCCGACAATCTCCAAAGACGCCACTCCCGCGACACCGTTGCCCGTCGGCGCCTGGCGAGTTCCCACC
CAGTTCACGCTGTTTATCGAGATCGAGGAAGCGGCTACTCTGCGCATCATCACGCGAGAGGAGTCCAAGAACTGG
CGTTGGCGCGGAAAGGAACCGGCCACGCTTCACAAAAAGGGGCCCAGCAAGCGCATGCAATGGAACCGGGCCAAG
AAGAACTCCAAGGGGGATGCATCTCATCCGAGGCCTGCCGGCTGGATGGAGATTAAGCTGCCGACAAACTCGACC
GTATCCTTCACGACGGACATGCTCGCCAGCACTTCGGGATACAAGACGAATGTCAACATTGACCTCCCCAGCGCA
GAGCTCAGTACCAGCGTCAATCACGACTTGCTCTACCGATGCGGAGCCCAGCGCATTACCTGCAATATGCCCATG
CCCCTGTCGTGGAACTCGCTCCGTATCTGGCATGTCACCGTCGACAGCGACGATCTGGACTTGTTTCTCCTTCGC
GATCACGTCTTCCTCCTGGCCGACCTCATCGCCGACTGGGGCGCCGGAGCCATGCCCGAGTATCTACAGTTTGTG
CCCTTTGAGTACTATCTGCACCTCAACTTCCGTAACGCGAGGCTCATCATCAACGTCAACGAACAAAACATCATT
GACAAAGCCACGGCCCCTGACGACAACACTTACATGATGCTTTCCAGTCCTCGCGTCAACGTCACCGTCCACATA
CCCATCGACAAGTTTCAGCCAGACAAGACGGCGGTTTCGTTTGACGTGAGGGCCGACACTCCCAACCTGGTCGTC
AACGTCCCTCAGTCGAGCACACAGGCCGCCATTCTGCCATGCACTGATCTGGGCGTTGCTGACGGCCTCGTCGTG
TCTGGGAGCTTCAATTTCAACTCGACCGTCGCCCCCGGGCTCACCGACACAATCGTCCTCAAGGTCCACGTCCAG
GCACCACACGTGCGCATCTACGGCTTCATCATGCGCTACATCGTGCTGCTGAGGGACAACATCTTTGCGGAATAC
ATGCACTTCAAGACGCTGGGCGAGTATCTGGAGTTGAAGAAACAGGGCGCCGACACGGTGACACCTCCCTCAAAC
ACGGGCATGAACGAGCTCGATCTCATCCTGGCTGTCAGGGTTGACGATCCCCGGGCCTTGATCGCGGCCAACGTC
TACTGCGGCGGCGAGCGCTGCATACAGGCCGATCTTGCTGACCTGTCACTCGATCTTCGCCTCAACAGCTACATC
ATGGACATGGAGGTTTCTCTGAGCCCAGTGAGTCTCTCGTTGGGCCGTCCGATGGAGGATGCCGAGTCTGTGAGC
GCCTCGTCGTCCGACACCCAAGTCTTCGCCGACGGGCTGCGCATCTTTTGCCATCGGACCTTTGGCCTGCCCGGT
AACGAGCAGGCCTATCTCACCAACTGGGACGTTGGCCTCGGGGCCATCAGCGGCGAATGCACGGCCGAGTTCCTC
GCTACCCTGGTCGGACTCGGCCTGTCGTTTCTCTTCACCTTTGACGACGCGGAGAACGCGCTGATACCGTATTCG
ATGCTTGTGTTTCCCGATCTCGTCTTCGCCCGTATAGCCGTCGATTCGTTCCATGTATGGGTTCACATCGATGAG
GCCGCTTTTCTCGTCTCGACAGACAAGATCGAACTCATCAGCAACGACTGGGCCCGCTCGCACTACTCCAAGCGC
ACCAACATCGTGATCCCCAATCTGCAGCTGTGTTGCGTCAATGCCGAGGCTGCTACCGCCAGACACACGTCTCGA
CGTCACCACGCGGCTAATACCGAGGCCTACTTGCAGACCGACATTCAGATCGCCATGGTCGGTCGAAAGTTTCAC
TTCTCCGCCGAGCGGAAATCACAGCAGGACTTGATCCGTCGCGAGGATCAGCGCACGGAGAGAACTCAGTTTCTT
CTCCTCGGCGACCCGGACCCTGATTTTGTACCGGATACCTTCGAGCCCCCGGCCCAACCATCTCCCATGCCGCCT
GTTCCCATCACCGAGGCCGACGTTAGTCTTCGTTCGCCTGGTGGTTCTTCGCACTTTGATCGCAATCGGGGCCCG
GGCCGTCAAAGCTCGTCACTTTCTCTATCCAGCAGCTACGAATCCAGACTCAACGGCGAGTCTCGCACGAAGCTG
AAAGACAAAAGAGGCGTCTTTGGCTCTACCGGGCGAAGAACGGCTTCGGGTCGGAGACTGGATGCCGCGTACGAG
TGGCGACGATCTACTTCTCGCGATCCTGCGGGTCTGTTTCCTTTCAAAGATAACCTTGACCATATGTCCGTTGCC
TTCTCGAGTCAATACTTCGCGCCTCATTTTCCTCTGGAGAGTGTCCGCGCAGACACGCGTGAGGCCGAGTATCCT
GAAGTCCCTGATGAGAGCTACGACGATGGTTTCTGGCAAACGGAAGCTTCTTTGGATGAGATTGATCCGTCCAGT
CTCAGTGAGGAGCACTCTCACGAAAGCACCATCATCGAGTTTCCCTCTGGCATTTCGGCATTTTTCAGGCCCGAG
GCGCTGCGACATGCCATCTCTCTCCTTGCTGAACTACAGCCCAAAGACCCGGAGAGCATCCTCGACTTTCTCCAG
GTTGGAGCCATCAACGAGGTGTTCGCCGCTCAGAAGCCGGAGTATGACCAGGGGACGATCCAGGAGATTAGCGTG
AGGATTCCAAGCGCGGAAATCCGAGTCCTCAACGACGCGACAGCTCATTCTTACGACGACTCGTGCGAAGAGCAA
GACCAATACGATGTGCGGCTCACGAAGCTTGCTCTGGTCAGTCGAACAGTCACAGAAAAGGGAGAGGCTGAGAAG
ATGGTCACCTCGGCGAACCCGAGGACATCGCTCCATTTTCGACTCAAGTCGGCAGAAGTCTGCGTGTCAGAGCGT
TCTGCGCCGCCGTCCAATCCTCAAGAAGCCCTTATGCTGGAGATTGACACCGTCATTCTGTCCCTGGGCACGAAA
GACGTCACTTACTTTGATGCTGATGTGGGCTCCGTGGTTGGAAGCACTGCTTCCGGCAAGATCGACTATATAGTC
TCTCTCATCCATCGGACCAGTAGCCTGGCTACAGATCTGGAGCGTATCATCACCGACACCACTGCCAGCTACGGC
AACCGAGCCCGGTATCTTGCTTATCATCTCTTGAGCGAGGGCTCGTCTACGAAAGATCCCTCGTTCTTTACGCGG
CCGTCTGCTGTTCTGAGATCGGCACCAACACACCTGCGGAGGACCGATACTTGGAAGCTGATCATGCGTCTTCGT
CAGATCTGGGCTACCATGGGAAACCGGAGGCGCTCTCAGCTGGCGGCAGCGTGTCATGACGGCTCCCTCGCGGTT
CCTCCCGATGCTCTCAATACTATAACTGCCGCATTTGAAAGGTGGCGCAGCTGGGACCTGGAAGATACCGCAAAC
TCTGTACTCGTCAAGCACCTTTTCGACGGAGAAAAGGACGGTGCAGATGTCAAGGCCGGACGCGACTTTCCTCTC
ATCGGGGCTTGCCGCCTTGGAGAGCTGCGGTTCGTCTTGGATCCGGGACCCAGACAGAATAATGTCGCCTTCATT
GATGTGGCCGTCCGGGTTGAGCAGAAGCCGGCCGACTCGAGCGATACCGTGCCGGAGATGGCCGGATTCAACGGC
CCCTTGACGGTCTGCAACATCAGCTGCAGCGAGGCTGAAATCCATCTCAACTGGGGGCTTTGCGAGTTGGCAGAA
GACCTTCTACGGCTATACAACCAAAGCCTCGCGAGCACCCTTGGCAATTTCGAATCCCACGACGCAGAGGTTTCG
AAATCGCCTCTACCGGCCTTCCACATCGCTTTCGAGCTTTCGAGGGGCTCCATCGACCTGGAGACTATCAACCTC
AGCTTGAAGACGTTGAGCTGTGGACTCAAGGGTTCCATCTTGGTGTACAGCATCGGTGACAAGACGGACTTTGCG
AGCTGCCTGCTCAACTGCAACACCATTACGTCGCGTCTGCATAGCGGTTCTCAGCTCCTGAGCGTCTTCCAGCTT
CGTCAGCCAAGCGTCTTTGTGTCCCACGAGCTGCAAGAGACGCAGGATGCCTCGCTGCGGACCATTAAATCAACC
GCTAGCAGCCAGGGGCTGAAGCTCGCTGTCAAACAGGACCCCATTGCTCTACTGGAAGTCATCGGCCTCCTCGTC
AAGGACGAAGCCGCGCAGCTCAGCCGTCTTCACGCTCAGTTTACGAGCTCACCTCCCCCGCCGAAGCCCGTCAAG
ATCTCAGACCGTCTGTCCAAGGTTCGGATCAATGTGGCCCTGTTTCTCGAGAGCTATACCATCAGTGTCTCGCTT
CTGCAGTCGCTCACCTGGAAGATTTCGGGCGTCGTGGCGCGAATGGCGTGTGCTGCGAACAATGGCAAGGAGGTC
ATCTTTGACTTTGACGTCAAGGAGAACTCGCACGAGATGCAGATCAAAATGGGGGATGAGCCTCGGAGCATCTCT
CTTCTTCAGATTCCTCCCATGAATGGTCGCATCAGGGGTCATGCGGGAGAACAGTCGGGGCATTCCTTGTCCGTG
CTCTCGTCTATCGAGGTCATTCGATTAGATGCTTCGGCCATTTACAGCTTGCTCGCCGTTCTCAACCGGCCGCAA
ATCTCCAACGCGGTTGACGACATGCAACAGCAGATCAAGGTCGTACAGGAGCACATCGAGGATGTCTTTGGAGGC
TCACGTCCGCCACCGCCCATCGAACCCGCTCCGCCTCGGCCGTTGCTGGCGTACGATGTTCACGTCACTCTCGCT
GGCCTGAGAATACTTGCCAAAACATCTCTGACATCCAAGAGCGAGCCGATGGCTCAGATCTACTTTTCGCTTGAC
AAGACATCCCTGCTTGCTTGCAACCAGCGTGATCCGCAGGAGCCCGCACTCAAGTATCCAGATCTGCACCTGAAC
CTGCTCCACGTCGGTCTCGACATCCGCAGGGGCTCAAAAGATGCCTCGAGATGCTGCGGCAGTATCGGGACAAGT
GCCACCGTCTCGGCGAGCTCACGGCGAGGGGATGACGGCAGGGAGGACTGGAATTTGAACTTTCGCAGCAATGTG
CTGGACGTTAATCTCTCTCCGGAGACGGTGTCTACGGTCATCGACGTGGTCGGATACCTGGGCACTAAGATTAAG
GATCTGGACACGTCTCGTGAACTCGAGTATCTAAGAAAGCTGAGGCAGCCCAAATCCCGAGCCGCCGCTGACGAC
CAGGAGAAGCCGGGAGACGAGGCAGACATCATCGACTCCGTGCTGGCGTCTGTCGTCTGTCAGTTCGAGCTGCGT
AACATCCGGGTGTGCTGGAATGTGGCGGACAAGTCGACAGAAAAGGACTCGGGCAAAGAAGACATGGTTCTGTCC
GTAGAGCTCATCGAGTTTGGGACCAGGACGAGGAAGTCGGCGAGGTTGACCATCTCCAGTATCTTGGTGCAGTCG
GTGCCACCTGGTCACGACAAGAGCGTGCGATCACTACACTCGGCGCTTCTTCCTTCGGTCATCTTTAACGCGGCA
TATACGTCGACGGCGGGAACCCGGCGGATGGCGTTTCAGGCCACGGGCGAGTCTCTCGACCTGCGGCTGACGTCT
GGCTTCATCGTGCCCGCTGCCAGCCTCGTCAAGTCTATTTCTCTGTCGTTCCGAAACGTGCAGAAGGCCTCAGCC
CAGTGGACGACGGACTCGACGGTGGCCCCGAAGAAGGCAGGCGAGTCATCTCCCGAGTCGGAGCAGCAGCAGCAG
CACTGGAGCTTCCTGGACAACAAGCGGCTTGAGAGCCTGCTCGTCGACGCCGACTTTGCAGGAGCCGTCGTGTAT
GTCTCCAGCAAGAATGCTGCTGGCAGCTCGCAGTCGGCGGATCAGAGCTGGCGGCCGGCTTTGGACGGCAAATAT
GGCCAGTTCAAAACGGATGACTTGGGGAGTGCAGTCGTTCTTCGCAGTCCGGGGGTTGCTGGCAAGGCTGAGTAC
AGAGACAGCGGCGGAGACGATCCCACGCTATACGGCGAGGTCAAGATCGACGCTTCCAGCAACACTCTGCACCCG
TCGGTGGTGCCCCTTGTCATGGACATCGTCTCGAGCGTCAAGGAGGTCGTCAGCGATGACGGCAGCCAGGACAAG
GGAGATGAGGAGGACGAGCCGCCCAAGCTGAAGCCGGAGCGGTCCGCGGATGAGGATAATATTCTCACGGCCGAT
CCGAGCGCCGTTTTGGGCCGAGTGAAGCTCAATCTCGGTCTTCGCATCTGCAGACAGGCATTCACCTTGAGCTGC
CAGCCGGTAGGACGCGTCGAGGCGACGGCCTGCTTCGACAATGTCTATTTTACCGTCAACACCGTCCACTCTCTC
GAGCAGGGCAACTTCTTCGCCATCTCGGGCACGCTGAGCCAGCCGCAGGCCTCGGTCCAGCACGTCTACTCGCGG
CAATCGACGGCCAGTTTCGGGGTTGATACGGTGACGGTGTCGTTTATGAATAGCAAGCACGTCAGCGGCACCAAC
GGCGTGTCGGTTATTCTCAAGGTGAGCCCGATGAAGGCGTCCATCAACGCGAAGCAGGCACAGGACTTCTTGCTT
TTCAGGGAGATCTGGCACCCGGACAATCCGCGTCATGCGGCAGCGAGGGGCCCCGTGGCCAAGCTCGAGACGGAG
ACGTCACAGGGGTATCTGGTGCAGCGATATCAGCAGGTGGCGGCTACGGCTGCCTTTCCCTGGACGGCCACGATC
TCTATCGCGGCGCTCGACGTCCATGTCGATCTGGGACAGGCCATTGGAAAGTCCGTCTTCCAGATCAGCGACTTC
TGGGTCTCGTCCAAGAAGACGTCCGACTGGGAGCAGAATCTCTGTCTGGGGTTCCAACGGATCGGCATTGATTGC
ACAGGCCGGCTGAGCGGCTTCATCGCCTTGCAGTCCTTCCGTCTACGGACATCGATCCAGTGGCCGAAGCGAGAA
GAGGCTCTCAACAAGACGCCACTGATACACGCGTCGTTGGCATTCAACGCCTGTCGTGCCAAGGCAGCCTTTGAT
TACCAGGCCTTCTTGGTTGCCGACATCACATCGCTCGACTTCCTCATGTACAATGTGCGGGAGAAGCGAGACGGA
AGCGGGGATCGACTGGTGGCCATGCTCGACGGCGAGGCGGTTCAAGTCTTCGGAACGACTGCGTCGGCAGCTCAG
GGCTTGAGGCTCTTTCAGGCCATCCAGAAGCTGGTGCAGGAGAAGAAGGAGAGCTTCGAGTCGTCTTTGCGGGAG
ATTGATAAGTTCACGAGACGCAAGGCGGCACGAACCTCGGATCAGCCAGCGGCGTCTTCGTCGGATGTGGTGGCG
GCCAAGTCGCCCATATCCCTGGACACGCATGTGGTGGTGACGTTCAAGGCGCTGAACCTCGGCGTCTTTCCCGCT
ACCTTTTCGGATCATCAGGTGTTCAAGGTGGAGGCGCTCAACGCTCACGCAAGGTTCTCTGCCAGCTTGGTACAA
CGACGGATCCATAGCGTGCTTCGCATGACGCTGGGCCAGCTACGGATCGGGCTGGCCGGGATGCGCAACGTCGAG
GCGCCCAAGCCGCTGAGCGAGGTGACGGTCGAGGACGTTGTGGCTCGGGTGACGGGTTCTCGCGGAGGGACCATT
CTCAATGTGCCGCGGGTAGAGGCCATGATGGAGACGTGGCAACGGCCAGACAGCAACCTCATCAGCTACATCTTC
AAGAGCGCGCTCGAGGGCAAAGTCGAAGTCGGCTGGAACTATTCGCGCATCAGCTACATCCGCGGCATGTGGGCC
AAGCACACCAAGGCGCTGGAGCAGATCTGGGGCCGACAGCTGCCCATGACGGCCGTCAAGATCACGGGTGTGCCG
GAGGCTGAGGCCGAGGCCGAGGTGGAGGCGAGTGCCGCACAAGGAGAGCCGGAAGTCGGAAGCAAAGACAAGGAC
GGCGCCGCGGGGCCGCGCGAGGGCGGACAGCAGAAGATCACGGCCGAGGTCAAGGTGCCGCAGTCCAAGTATGAG
TACGAAGCGCTGGAGCCGCCCATCATCGACACGCCGCAGCTGCGCGACATGGGAGAGGCGACGCCGCCGCTCGAG
TGGATAGGGCTGCACCGGGATAAGCTGCCCAACTTGACTCATCAGATGGTCATTGTGTCGCTGCTGGAGCTTGCC
GGAGAGGTGGAGGATGCATATTCGCGGATCCTGGGGTCGTCATGA
Gene >Ophun1|3841
ATGTCCCTTGTCGACGACGTGATCGTGGCCCGATCGCCAGAGCGTCCCGAGTACAGGGCGTAAGAATCCAGCCCA
CCCGAGCGTCCCGATGCCGTGACTAACGCCCTTGACCTCAAGCGTGCTCCCGGTCTTGTACATCATCGCCGCGCT
GCTCGTCATCTTCTTTCTTCTCTACTTTAATCGAGTCTTTGCCTCCATCGTCTCGTACGGCATCAGGGCCTTTAC
CTGGAATCAGTACCGAATCTTCATCGACTTCAAGGCTTTGCAGATATCCCTCCTCGCCGGCCGCATCTTCTTTAC
CGGCCTGCGCTACCACGGCTCCAACGAGACTCTACTGGTGCAGCACGGCACTATAACATGGCGGTACTGGCTGCG
TCGAGTACGAGACGTCGACGTCCAGGCGTCCAGCTGCTCGGGCGAGGATGCCGGCTCCAAGCAGGCCAGGAATGC
CGCCCTTCCCTGTCGCATCAACGTCAACGTCGTCGGCGTCGAGATCTTCATCTACAACCGCAGTCCCGCTTACGA
CACTATTCTCTCCGGAATCGTCGGCAGCGGCTCTTCTGGCGGAGCTTCCACCGGCGTCTTCGTCGGCCAGGACGA
GGGCACCGTCAGGCCGAGAAAGTCGGACTCGAACCAGGAGGACAAGGATGACTCAGGGGCAAAGACGGAAAAGTC
TCGAGACTCTACCTCGGCTCGTTCCGGCTCAGATGCACCTCACAGAGGTCCTATCGGCGGAAAACGAGAGGAAGC
ACAACTCCCATTCATCCTCCAACTACTTCCCATCCACGTCGACTGTCAAAAAGCCGCCATAGTCATAGGCAATGA
CACGACCAAGGCCATCCTCACGGCAAAGGCCAACTCGGCGGCCATCGATATAGACGCCTCGCCCACTCATACGTG
CGATCCATACCGACAGATCGCCAAAGTGACGGTTGAACGGCCCAAGATCGAGACGAGGGACAACGAGGGCTTCAA
GGAAGATCAGATTGCTCGCGCCACCAGGCGCCAGGAAGATGAGCGACAGGCAGAACCACCTCTGCACAAGGCCTT
TCTACGACGCACCCGTCGTCGGCTCCTCGACCCCCTGCGGAAAATCGTTCCCTGGTGGCGACGGTCTGTCGAGCC
CTTCTCGGCCGAATCGAAATCAGCCGGGGCAACGAGAGCGGCCCAGGTCCCGGGAGCGGCCCAATGGCAAGGCCT
CTCCCGATATCTGGACGAACAAGACCAAGACGACAAAGCACGGTGGACGTCGGTAGAATACGGTGCAGTCCCGAC
CATCGTGGACTCGCCTCAGGTGACCATCACTCTCTTCTGGGATGTTCCGGGTCGCGTGACAGAGCAGGCTCACTT
GAACGGTGCTACGAGTTCGCCACCCGATGTCAACGGCAGCGAGCCGCCTGCTTGGGGCATGAGTCTCTCCGTCAA
AGGAGGCACCGTCAACTACGGCCCTTGGACAGACCGGCAGCGGTTCGCTCTACAGAGCATGTTCTTCCCGACAAT
CTCCAAAGACGCCACTCCCGCGACACCGTTGCCCGTCGGCGCCTGGCGAGTTCCCACCCAGTTCACGCTGTTTAT
CGAGATCGAGGAAGCGGCTACTCTGCGCATCATCACGCGAGAGGAGTCCAAGAACTGGCGTTGGCGCGGAAAGGA
ACCGGCCACGCTTCACAAAAAGGGGCCCAGCAAGCGCATGCAATGGAACCGGGCCAAGAAGAACTCCAAGGGGGA
TGCATCTCATCCGAGGCCTGCCGGCTGGATGGAGATTAAGCTGCCGACAAACTCGACCGTATCCTTCACGACGGA
CATGCTCGCCAGCACTTCGGGATACAAGACGAATGTCAACATTGACCTCCCCAGCGCAGAGCTCAGTACCAGCGT
CAATCACGACTTGCTCTACCGATGCGGAGCCCAGCGCATTACCTGCAATATGCCCATGCCCCTGTCGTGGAACTC
GCTCCGTATCTGGCATGTCACCGTCGACAGCGACGATCTGGACTTGTTTCTCCTTCGCGATCACGTCTTCCTCCT
GGCCGACCTCATCGCCGACTGGGGCGCCGGAGCCATGCCCGAGTATCTACAGTTTGTGCCCTTTGAGTACTATCT
GCACCTCAACTTCCGTAACGCGAGGCTCATCATCAACGTCAACGAACAAAACATCATTGACAAAGCCACGGCCCC
TGACGACAACACTTACATGATGCTTTCCAGTCCTCGCGTCAACGTCACCGTCCACATACCCATCGACAAGTTTCA
GCCAGACAAGACGGCGGTTTCGTTTGACGTGAGGGCCGACACTCCCAACCTGGTCGTCAACGTCCCTCAGTCGAG
CACACAGGCCGCCATTCTGCCATGCACTGATCTGGGCGTTGCTGACGGCCTCGTCGTGTCTGGGAGCTTCAATTT
CAACTCGACCGTCGCCCCCGGGCTCACCGACACAATCGTCCTCAAGGTCCACGTCCAGGCACCACACGTGCGCAT
CTACGGCTTCATCATGCGCTACATCGTGCTGCTGAGGGACAACATCTTTGCGGAATACATGCACTTCAAGACGCT
GGGCGAGTATCTGGAGTTGAAGAAACAGGGCGCCGACACGGTGACACCTCCCTCAAACACGGGCATGAACGAGCT
CGATCTCATCCTGGCTGTCAGGGTTGACGATCCCCGGGCCTTGATCGCGGCCAACGTCTACTGCGGCGGCGAGCG
CTGCATACAGGCCGATCTTGCTGACCTGTCACTCGATCTTCGCCTCAACAGCTACATCATGGACATGGAGGTTTC
TCTGAGCCCAGTGAGTCTCTCGTTGGGCCGTCCGATGGAGGATGCCGAGTCTGTGAGCGCCTCGTCGTCCGACAC
CCAAGTCTTCGCCGACGGGCTGCGCATCTTTTGCCATCGGACCTTTGGCCTGCCCGGTAACGAGCAGGCCTATCT
CACCAACTGGGACGTTGGCCTCGGGGCCATCAGCGGCGAATGCACGGCCGAGTTCCTCGCTACCCTGGTCGGACT
CGGCCTGTCGTTTCTCTTCACCTTTGACGACGCGGAGAACGCGCTGATACCGTATTCGATGCTTGTGTTTCCCGA
TCTCGTCTTCGCCCGTATAGCCGTCGATTCGTTCCATGTATGGGTTCACATCGATGAGGCCGCTTTTCTCGTCTC
GACAGACAAGATCGAACTCATCAGCAACGACTGGGCCCGCTCGCACTACTCCAAGCGCACCAACATCGTGATCCC
CAATCTGCAGCTGTGTTGCGTCAATGCCGAGGCTGCTACCGCCAGACACACGTCTCGACGTCACCACGCGGCTAA
TACCGAGGCCTACTTGCAGACCGACATTCAGATCGCCATGGTCGGTCGAAAGTTTCACTTCTCCGCCGAGCGGAA
ATCACAGCAGGACTTGATCCGTCGCGAGGATCAGCGCACGGAGAGAACTCAGTTTCTTCTCCTCGGCGACCCGGA
CCCTGATTTTGTACCGGATACCTTCGAGCCCCCGGCCCAACCATCTCCCATGCCGCCTGTTCCCATCACCGAGGC
CGACGTTAGTCTTCGTTCGCCTGGTGGTTCTTCGCACTTTGATCGCAATCGGGGCCCGGGCCGTCAAAGCTCGTC
ACTTTCTCTATCCAGCAGCTACGAATCCAGACTCAACGGCGAGTCTCGCACGAAGCTGAAAGACAAAAGAGGCGT
CTTTGGCTCTACCGGGCGAAGAACGGCTTCGGGTCGGAGACTGGATGCCGCGTACGAGTGGCGACGATCTACTTC
TCGCGATCCTGCGGGTCTGTTTCCTTTCAAAGATAACCTTGACCATATGTCCGTTGCCTTCTCGAGTCAATACTT
CGCGCCTCATTTTCCTCTGGAGAGTGTCCGCGCAGACACGCGTGAGGCCGAGTATCCTGAAGTCCCTGATGAGAG
CTACGACGATGGTTTCTGGCAAACGGAAGCTTCTTTGGATGAGATTGATCCGTCCAGTCTCAGTGAGGAGCACTC
TCACGAAAGCACCATCATCGAGTTTCCCTCTGGCATTTCGGCATTTTTCAGGCCCGAGGCGCTGCGACATGCCAT
CTCTCTCCTTGCTGAACTACAGCCCAAAGACCCGGAGAGCATCCTCGACTTTCTCCAGGTTGGAGCCATCAACGA
GGTGTTCGCCGCTCAGAAGCCGGAGTATGACCAGGGGACGATCCAGGAGATTAGCGTGAGGATTCCAAGCGCGGA
AATCCGAGTCCTCAACGACGCGACAGCTCATTCTTACGACGACTCGTGCGAAGAGCAAGACCAATACGATGTGCG
GCTCACGAAGCTTGCTCTGGTCAGTCGAACAGTCACAGAAAAGGGAGAGGCTGAGAAGATGGTCACCTCGGCGAA
CCCGAGGACATCGCTCCATTTTCGACTCAAGTCGGCAGAAGTCTGCGTGTCAGAGCGTTCTGCGCCGCCGTCCAA
TCCTCAAGAAGCCCTTATGCTGGAGATTGACACCGTCATTCTGTCCCTGGGCACGAAAGACGTCACTTACTTTGA
TGCTGATGTGGGCTCCGTGGTTGGAAGCACTGCTTCCGGCAAGATCGACTATATAGTCTCTCTCATCCATCGGAC
CAGTAGCCTGGCTACAGATCTGGAGCGTATCATCACCGACACCACTGCCAGCTACGGCAACCGAGCCCGGTATCT
TGCTTATCATCTCTTGAGCGAGGGCTCGTCTACGAAAGATCCCTCGTTCTTTACGCGGCCGTCTGCTGTTCTGAG
ATCGGCACCAACACACCTGCGGAGGACCGATACTTGGAAGCTGATCATGCGTCTTCGTCAGATCTGGGCTACCAT
GGGAAACCGGAGGCGCTCTCAGCTGGCGGCAGCGTGTCATGACGGCTCCCTCGCGGTTCCTCCCGATGCTCTCAA
TACTATAACTGCCGCATTTGAAAGGTGGCGCAGCTGGGACCTGGAAGATACCGCAAACTCTGTACTCGTCAAGCA
CCTTTTCGACGGAGAAAAGGACGGTGCAGATGTCAAGGCCGGACGCGACTTTCCTCTCATCGGGGCTTGCCGCCT
TGGAGAGCTGCGGTTCGTCTTGGATCCGGGACCCAGACAGAATAATGTCGCCTTCATTGATGTGGCCGTCCGGGT
TGAGCAGAAGCCGGCCGACTCGAGCGATACCGTGCCGGAGATGGCCGGATTCAACGGCCCCTTGACGGTCTGCAA
CATCAGCTGCAGCGAGGCTGAAATCCATCTCAACTGGGGGCTTTGCGAGTTGGCAGAAGACCTTCTACGGCTATA
CAACCAAAGCCTCGCGAGCACCCTTGGCAATTTCGAATCCCACGACGCAGAGGTTTCGAAATCGCCTCTACCGGC
CTTCCACATCGCTTTCGAGCTTTCGAGGGGCTCCATCGACCTGGAGACTATCAACCTCAGCTTGAAGACGTTGAG
CTGTGGACTCAAGGGTTCCATCTTGGTGTACAGCATCGGTGACAAGACGGACTTTGCGAGCTGCCTGCTCAACTG
CAACACCATTACGTCGCGTCTGCATAGCGGTTCTCAGCTCCTGAGCGTCTTCCAGCTTCGTCAGCCAAGCGTCTT
TGTGTCCCACGAGCTGCAAGAGACGCAGGATGCCTCGCTGCGGACCATTAAATCAACCGCTAGCAGCCAGGGGCT
GAAGCTCGCTGTCAAACAGGACCCCATTGCTCTACTGGAAGTCATCGGCCTCCTCGTCAAGGACGAAGCCGCGCA
GCTCAGCCGTCTTCACGCTCAGTTTACGAGCTCACCTCCCCCGCCGAAGCCCGTCAAGATCTCAGACCGTCTGTC
CAAGGTTCGGATCAATGTGGCCCTGTTTCTCGAGAGCTATACCATCAGTGTCTCGCTTCTGCAGTCGCTCACCTG
GAAGATTTCGGGCGTCGTGGCGCGAATGGCGTGTGCTGCGAACAATGGCAAGGAGGTCATCTTTGACTTTGACGT
CAAGGAGAACTCGCACGAGATGCAGATCAAAATGGGGGATGAGCCTCGGAGCATCTCTCTTCTTCAGATTCCTCC
CATGAATGGTCGCATCAGGGGTCATGCGGGAGAACAGTCGGGGCATTCCTTGTCCGTGCTCTCGTCTATCGAGGT
CATTCGATTAGATGCTTCGGCCATTTACAGCTTGCTCGCCGTTCTCAACCGGCCGCAAATCTCCAACGCGGTTGA
CGACATGCAACAGCAGATCAAGGTCGTACAGGAGCACATCGAGGATGTCTTTGGAGGCTCACGTCCGCCACCGCC
CATCGAACCCGCTCCGCCTCGGCCGTTGCTGGCGTACGATGTTCACGTCACTCTCGCTGGCCTGAGAATACTTGC
CAAAACATCTCTGACATCCAAGAGCGAGCCGATGGCTCAGATCTACTTTTCGCTTGACAAGACATCCCTGCTTGC
TTGCAACCAGCGTGATCCGCAGGAGCCCGCACTCAAGTATCCAGATCTGCACCTGAACCTGCTCCACGTCGGTCT
CGACATCCGCAGGGGCTCAAAAGATGCCTCGAGATGCTGCGGCAGTATCGGGACAAGTGCCACCGTCTCGGCGAG
CTCACGGCGAGGGGATGACGGCAGGGAGGACTGGAATTTGAACTTTCGCAGCAATGTGCTGGACGTTAATCTCTC
TCCGGAGACGGTGTCTACGGTCATCGACGTGGTCGGATACCTGGGCACTAAGATTAAGGATCTGGACACGTCTCG
TGAACTCGAGTATCTAAGAAAGCTGAGGCAGCCCAAATCCCGAGCCGCCGCTGACGACCAGGAGAAGCCGGGAGA
CGAGGCAGACATCATCGACTCCGTGCTGGCGTCTGTCGTCTGTCAGTTCGAGCTGCGTAACATCCGGGTGTGCTG
GAATGTGGCGGACAAGTCGACAGAAAAGGACTCGGGCAAAGAAGACATGGTTCTGTCCGTAGAGCTCATCGAGTT
TGGGACCAGGACGAGGAAGTCGGCGAGGTTGACCATCTCCAGTATCTTGGTGCAGTCGGTGCCACCTGGTCACGA
CAAGAGCGTGCGATCACTACACTCGGCGCTTCTTCCTTCGGTCATCTTTAACGCGGCATATACGTCGACGGCGGG
AACCCGGCGGATGGCGTTTCAGGCCACGGGCGAGTCTCTCGACCTGCGGCTGACGTCTGGCTTCATCGTGCCCGC
TGCCAGCCTCGTCAAGTCTATTTCTCTGTCGTTCCGAAACGTGCAGAAGGCCTCAGCCCAGTGGACGACGGACTC
GACGGTGGCCCCGAAGAAGGCAGGCGAGTCATCTCCCGAGTCGGAGCAGCAGCAGCAGCACTGGAGCTTCCTGGA
CAACAAGCGGCTTGAGAGCCTGCTCGTCGACGCCGACTTTGCAGGAGCCGTCGTGTATGTCTCCAGCAAGAATGC
TGCTGGCAGCTCGCAGTCGGCGGATCAGAGCTGGCGGCCGGCTTTGGACGGCAAATATGGCCAGTTCAAAACGGA
TGACTTGGGGAGTGCAGTCGTTCTTCGCAGTCCGGGGGTTGCTGGCAAGGCTGAGTACAGAGACAGCGGCGGAGA
CGATCCCACGCTATACGGCGAGGTCAAGATCGACGCTTCCAGCAACACTCTGCACCCGTCGGTGGTGCCCCTTGT
CATGGACATCGTCTCGAGCGTCAAGGAGGTCGTCAGCGATGACGGCAGCCAGGACAAGGGAGATGAGGAGGACGA
GCCGCCCAAGCTGAAGCCGGAGCGGTCCGCGGATGAGGATAATATTCTCACGGCCGATCCGAGCGCCGTTTTGGG
CCGAGTGAAGCTCAATCTCGGTCTTCGCATCTGCAGACAGGCATTCACCTTGAGCTGCCAGCCGGTAGGACGCGT
CGAGGCGACGGCCTGCTTCGACAATGTCTATTTTACCGTCAACACCGTCCACTCTCTCGAGCAGGGCAACTTCTT
CGCCATCTCGGGCACGCTGAGCCAGCCGCAGGCCTCGGTCCAGCACGTCTACTCGCGGCAATCGACGGCCAGTTT
CGGGGTTGATACGGTGACGGTGTCGTTTATGAATAGCAAGCACGTCAGCGGCACCAACGGCGTGTCGGTTATTCT
CAAGGTGAGCCCGATGAAGGCGTCCATCAACGCGAAGCAGGCACAGGACTTCTTGCTTTTCAGGGAGATCTGGCA
CCCGGACAATCCGCGTCATGCGGCAGCGAGGGGCCCCGTGGCCAAGCTCGAGACGGAGACGTCACAGGGGTATCT
GGTGCAGCGATATCAGCAGGTGGCGGCTACGGCTGCCTTTCCCTGGACGGCCACGATCTCTATCGCGGCGCTCGA
CGTCCATGTCGATCTGGGACAGGCCATTGGAAAGTCCGTCTTCCAGATCAGCGACTTCTGGGTCTCGTCCAAGAA
GACGTCCGACTGGGAGCAGAATCTCTGTCTGGGGTTCCAACGGATCGGCATTGATTGCACAGGCCGGCTGAGCGG
CTTCATCGCCTTGCAGTCCTTCCGTCTACGGACATCGATCCAGTGGCCGAAGCGAGAAGAGGCTCTCAACAAGAC
GCCACTGATACACGCGTCGTTGGCATTCAACGCCTGTCGTGCCAAGGCAGCCTTTGATTACCAGGCCTTCTTGGT
TGCCGACATCACATCGCTCGACTTCCTCATGTACAATGTGCGGGAGAAGCGAGACGGAAGCGGGGATCGACTGGT
GGCCATGCTCGACGGCGAGGCGGTTCAAGTCTTCGGAACGACTGCGTCGGCAGCTCAGGGCTTGAGGCTCTTTCA
GGCCATCCAGAAGCTGGTGCAGGAGAAGAAGGAGAGCTTCGAGTCGTCTTTGCGGGAGATTGATAAGTTCACGAG
ACGCAAGGCGGCACGAACCTCGGATCAGCCAGCGGCGTCTTCGTCGGATGTGGTGGCGGCCAAGTCGCCCATATC
CCTGGACACGCATGTGGTGGTGACGTTCAAGGCGCTGAACCTCGGCGTCTTTCCCGCTACCTTTTCGGATCATCA
GGTGTTCAAGGTGGAGGCGCTCAACGCTCACGCAAGGTTCTCTGCCAGCTTGGTACAACGACGGATCCATAGCGT
GCTTCGCATGACGCTGGGCCAGCTACGGATCGGGCTGGCCGGGATGCGCAACGTCGAGGCGCCCAAGCCGCTGAG
CGAGGTGACGGTCGAGGACGTTGTGGCTCGGGTGACGGGTTCTCGCGGAGGGACCATTCTCAATGTGCCGCGGGT
AGAGGCCATGATGGAGACGTGGCAACGGCCAGACAGCAACCTCATCAGCTACATCTTCAAGAGCGCGCTCGAGGG
CAAAGTCGAAGTCGGCTGGAACTATTCGCGCATCAGCTACATCCGCGGCATGTGGGCCAAGCACACCAAGGCGCT
GGAGCAGATCTGGGGCCGACAGCTGCCCATGACGGCCGTCAAGATCACGGGTGTGCCGGAGGCTGAGGCCGAGGC
CGAGGTGGAGGCGAGTGCCGCACAAGGAGAGCCGGAAGTCGGAAGCAAAGACAAGGACGGCGCCGCGGGGCCGCG
CGAGGGCGGACAGCAGAAGATCACGGCCGAGGTCAAGGTGCCGCAGTCCAAGTATGAGTACGAAGCGCTGGAGCC
GCCCATCATCGACACGCCGCAGCTGCGCGACATGGGAGAGGCGACGCCGCCGCTCGAGTGGATAGGGCTGCACCG
GGATAAGCTGCCCAACTTGACTCATCAGATGGTCATTGTGTCGCTGCTGGAGCTTGCCGGAGAGGTGGAGGATGC
ATATTCGCGGATCCTGGGGTCGTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail