Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3834
Gene name
LocationContig_345:3346..3952
Strand-
Gene length (bp)606
Transcript length (bp)606
Coding sequence length (bp)606
Protein length (aa) 202

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup891
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1571
Ophiocordyceps australis map64 (Brazil) OphauB2|4549
Ophiocordyceps camponoti-floridani Ophcf2|03131
Ophiocordyceps camponoti-rufipedis Ophun1|3833
Ophiocordyceps camponoti-rufipedis Ophun1|3834 (this protein)
Ophiocordyceps kimflemingae Ophio5|3076
Ophiocordyceps subramaniannii Hirsu2|5622

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3834
MQPKLTLVTYSRVHSCWPGDKEPGAANNMVLEPPFRMETAWRGFLMRESVQRSQLLPTSTGLVLPIETASTPATT
PSDPPSANPWSDGLVDDMDRGSRCVCVERCSDTSPVTPKLEPMDDDINLSLVKLAPSTPPTLRSPVPNEPLAKQR
RPRGRPRKMCLASPTGGTSKATNGRSKTGCITCRKRKKKCDEAKPRCTLSP*
Coding >Ophun1|3834
ATGCAGCCCAAGCTTACACTTGTGACGTATTCACGAGTTCACTCTTGCTGGCCAGGAGACAAGGAGCCCGGTGCA
GCCAATAACATGGTTCTGGAACCGCCGTTCCGGATGGAAACTGCCTGGAGGGGCTTCTTGATGAGAGAGTCGGTC
CAACGAAGCCAGCTATTGCCCACGAGCACCGGCCTTGTCCTACCCATCGAGACTGCTTCCACGCCAGCAACAACA
CCTTCGGATCCTCCTTCTGCCAATCCCTGGAGCGACGGCCTTGTCGACGACATGGACAGGGGAAGCCGTTGTGTT
TGTGTGGAGCGATGCAGCGACACCTCACCGGTTACCCCCAAGCTGGAACCGATGGATGACGATATAAACCTCAGC
CTCGTGAAGCTCGCCCCGTCCACACCGCCAACGCTACGAAGTCCCGTCCCGAACGAACCTCTGGCCAAGCAGAGA
CGACCCCGAGGTCGGCCGAGGAAGATGTGTCTGGCCAGTCCAACCGGAGGCACAAGCAAGGCGACGAATGGCCGG
TCCAAGACGGGCTGCATCACTTGCAGGAAGAGAAAGAAGAAATGTGACGAGGCGAAGCCACGATGTACGCTCTCA
CCTTGA
Transcript >Ophun1|3834
ATGCAGCCCAAGCTTACACTTGTGACGTATTCACGAGTTCACTCTTGCTGGCCAGGAGACAAGGAGCCCGGTGCA
GCCAATAACATGGTTCTGGAACCGCCGTTCCGGATGGAAACTGCCTGGAGGGGCTTCTTGATGAGAGAGTCGGTC
CAACGAAGCCAGCTATTGCCCACGAGCACCGGCCTTGTCCTACCCATCGAGACTGCTTCCACGCCAGCAACAACA
CCTTCGGATCCTCCTTCTGCCAATCCCTGGAGCGACGGCCTTGTCGACGACATGGACAGGGGAAGCCGTTGTGTT
TGTGTGGAGCGATGCAGCGACACCTCACCGGTTACCCCCAAGCTGGAACCGATGGATGACGATATAAACCTCAGC
CTCGTGAAGCTCGCCCCGTCCACACCGCCAACGCTACGAAGTCCCGTCCCGAACGAACCTCTGGCCAAGCAGAGA
CGACCCCGAGGTCGGCCGAGGAAGATGTGTCTGGCCAGTCCAACCGGAGGCACAAGCAAGGCGACGAATGGCCGG
TCCAAGACGGGCTGCATCACTTGCAGGAAGAGAAAGAAGAAATGTGACGAGGCGAAGCCACGATGTACGCTCTCA
CCTTGA
Gene >Ophun1|3834
ATGCAGCCCAAGCTTACACTTGTGACGTATTCACGAGTTCACTCTTGCTGGCCAGGAGACAAGGAGCCCGGTGCA
GCCAATAACATGGTTCTGGAACCGCCGTTCCGGATGGAAACTGCCTGGAGGGGCTTCTTGATGAGAGAGTCGGTC
CAACGAAGCCAGCTATTGCCCACGAGCACCGGCCTTGTCCTACCCATCGAGACTGCTTCCACGCCAGCAACAACA
CCTTCGGATCCTCCTTCTGCCAATCCCTGGAGCGACGGCCTTGTCGACGACATGGACAGGGGAAGCCGTTGTGTT
TGTGTGGAGCGATGCAGCGACACCTCACCGGTTACCCCCAAGCTGGAACCGATGGATGACGATATAAACCTCAGC
CTCGTGAAGCTCGCCCCGTCCACACCGCCAACGCTACGAAGTCCCGTCCCGAACGAACCTCTGGCCAAGCAGAGA
CGACCCCGAGGTCGGCCGAGGAAGATGTGTCTGGCCAGTCCAACCGGAGGCACAAGCAAGGCGACGAATGGCCGG
TCCAAGACGGGCTGCATCACTTGCAGGAAGAGAAAGAAGAAATGTGACGAGGCGAAGCCACGATGTACGCTCTCA
CCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail