Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3831
Gene name
LocationContig_344:18162..18693
Strand-
Gene length (bp)531
Transcript length (bp)531
Coding sequence length (bp)531
Protein length (aa) 177

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12296 HsbA Hydrophobic surface binding protein A 4.6E-24 27 145

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8TG42|MP1_ASPFL Cell wall mannoprotein 1 OS=Aspergillus flavus GN=mp1 PE=2 SV=1 22 175 7.0E-09
sp|Q9HFP8|MP1_ASPFM Cell wall mannoprotein 1 OS=Neosartorya fumigata GN=MP1 PE=1 SV=1 1 175 1.0E-05

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.992396

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5424
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7719
Ophiocordyceps australis map64 (Brazil) OphauB2|5884
Ophiocordyceps camponoti-rufipedis Ophun1|3831 (this protein)
Ophiocordyceps kimflemingae Ophio5|1279
Ophiocordyceps subramaniannii Hirsu2|5836

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3831
MLLSTLLVPLTATLAASAALDMQAAPANISDAIAQVSHEAETFGKVLTDWNGMLLTTLPIVTSSARLYHSLQKGT
RAAEASKPLTEDEALAMAADAQTLSQTVNKTLEAVIAVKPKFDRLWLSGVILGAMEIERKEAVEFIDAVVDKVPE
GFRPLAKRIVQGMLDGFEKTIAAYRP*
Coding >Ophun1|3831
ATGCTTCTCTCAACCCTCCTCGTCCCCTTGACGGCCACCCTCGCCGCCTCGGCAGCCCTCGACATGCAAGCCGCC
CCGGCCAACATAAGCGACGCCATCGCCCAAGTCAGCCACGAAGCCGAAACCTTTGGCAAAGTCCTCACCGACTGG
AACGGAATGCTCCTCACCACACTCCCCATCGTCACCTCGTCAGCCCGCCTCTACCACTCGCTGCAGAAGGGCACG
CGCGCGGCCGAGGCCTCCAAGCCGCTGACAGAGGACGAGGCGCTGGCCATGGCGGCGGACGCGCAGACGCTGTCG
CAGACGGTCAACAAGACGCTCGAGGCCGTGATAGCCGTCAAGCCCAAGTTTGATAGGCTTTGGCTTTCGGGGGTG
ATTCTGGGGGCCATGGAGATTGAGAGGAAGGAGGCGGTTGAGTTCATTGATGCCGTGGTTGACAAGGTGCCCGAG
GGATTCCGGCCGTTGGCTAAGAGGATTGTTCAGGGGATGCTTGATGGCTTTGAGAAGACGATTGCTGCCTATAGG
CCTTAG
Transcript >Ophun1|3831
ATGCTTCTCTCAACCCTCCTCGTCCCCTTGACGGCCACCCTCGCCGCCTCGGCAGCCCTCGACATGCAAGCCGCC
CCGGCCAACATAAGCGACGCCATCGCCCAAGTCAGCCACGAAGCCGAAACCTTTGGCAAAGTCCTCACCGACTGG
AACGGAATGCTCCTCACCACACTCCCCATCGTCACCTCGTCAGCCCGCCTCTACCACTCGCTGCAGAAGGGCACG
CGCGCGGCCGAGGCCTCCAAGCCGCTGACAGAGGACGAGGCGCTGGCCATGGCGGCGGACGCGCAGACGCTGTCG
CAGACGGTCAACAAGACGCTCGAGGCCGTGATAGCCGTCAAGCCCAAGTTTGATAGGCTTTGGCTTTCGGGGGTG
ATTCTGGGGGCCATGGAGATTGAGAGGAAGGAGGCGGTTGAGTTCATTGATGCCGTGGTTGACAAGGTGCCCGAG
GGATTCCGGCCGTTGGCTAAGAGGATTGTTCAGGGGATGCTTGATGGCTTTGAGAAGACGATTGCTGCCTATAGG
CCTTAG
Gene >Ophun1|3831
ATGCTTCTCTCAACCCTCCTCGTCCCCTTGACGGCCACCCTCGCCGCCTCGGCAGCCCTCGACATGCAAGCCGCC
CCGGCCAACATAAGCGACGCCATCGCCCAAGTCAGCCACGAAGCCGAAACCTTTGGCAAAGTCCTCACCGACTGG
AACGGAATGCTCCTCACCACACTCCCCATCGTCACCTCGTCAGCCCGCCTCTACCACTCGCTGCAGAAGGGCACG
CGCGCGGCCGAGGCCTCCAAGCCGCTGACAGAGGACGAGGCGCTGGCCATGGCGGCGGACGCGCAGACGCTGTCG
CAGACGGTCAACAAGACGCTCGAGGCCGTGATAGCCGTCAAGCCCAAGTTTGATAGGCTTTGGCTTTCGGGGGTG
ATTCTGGGGGCCATGGAGATTGAGAGGAAGGAGGCGGTTGAGTTCATTGATGCCGTGGTTGACAAGGTGCCCGAG
GGATTCCGGCCGTTGGCTAAGAGGATTGTTCAGGGGATGCTTGATGGCTTTGAGAAGACGATTGCTGCCTATAGG
CCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail