Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3828
Gene name
LocationContig_344:7497..8895
Strand-
Gene length (bp)1398
Transcript length (bp)1398
Coding sequence length (bp)1398
Protein length (aa) 466

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999763

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6034
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|00471
Ophiocordyceps camponoti-rufipedis Ophun1|3828 (this protein)
Ophiocordyceps kimflemingae Ophio5|1274
Ophiocordyceps subramaniannii Hirsu2|1371

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3828
MKFNAIVAIALVTGASAAPQPWCKRPNSICSKVKRAADIVAEVAAQDATAELTHLLTLSEEEPEQYSSEALGIDI
DKRSPEPWCKRPNSQCGTAMEKRSPTPWCSRPNSSCPTVAKRSPWCKRPNSICSKVKRAADAVVEVAAEDATEEL
SQLLENNEQHSEVLGFSDKTMDKRWCTRPLSNCPTKRSPWCKRPNSICSKVKRSPWCKRPNSICSKVKRSLVERA
PEPWCHRPNSMCWKVRRALSLETRSPWCTRPLSNCPTVVKRTPWCKRPNSICSKVKRSLSLETRSPWCTRPLSNC
PTVAKRSPWCKRPNSICSKAKRAVDVFADTVLQSVKQDSAAPQTASEAAAHDAVLKLAQLAAQSSESPEDYIKYL
GLEDNKTVAKRDVESTSETEAEEKEACHAEGGACWAAKRAVDAVLATVDAEQDDAEDDAECSQRGEACWHQKRQL
GALRFAANDISSSLL*
Coding >Ophun1|3828
ATGAAGTTCAACGCCATCGTCGCCATCGCCCTCGTCACGGGCGCCTCTGCCGCGCCTCAGCCCTGGTGCAAACGC
CCCAACTCCATCTGCTCCAAAGTCAAGAGGGCTGCCGATATCGTGGCCGAAGTGGCCGCTCAGGACGCCACTGCC
GAGCTCACTCACCTCCTGACGCTCTCCGAGGAAGAGCCCGAGCAGTACAGCTCCGAGGCTCTCGGCATCGACATC
GACAAGCGCTCGCCTGAGCCCTGGTGCAAGCGTCCCAATTCGCAGTGCGGCACCGCCATGGAGAAGCGCTCGCCC
ACTCCCTGGTGCAGTCGTCCCAACTCCAGCTGCCCGACCGTCGCCAAGCGCAGCCCCTGGTGCAAGCGTCCCAAT
TCCATCTGCTCCAAGGTCAAGAGGGCCGCCGATGCCGTCGTCGAAGTGGCCGCCGAGGATGCCACTGAAGAGCTC
AGCCAGCTTCTGGAGAACAACGAACAGCACTCGGAAGTCCTCGGATTCTCCGACAAGACCATGGACAAGCGCTGG
TGCACTCGTCCCCTCTCCAACTGCCCAACCAAGCGCAGCCCCTGGTGCAAGCGTCCCAACTCCATCTGCTCCAAG
GTCAAGCGCAGCCCCTGGTGCAAGCGACCCAACTCCATCTGCTCCAAGGTCAAGAGGTCTCTCGTCGAGCGCGCG
CCTGAGCCCTGGTGCCACCGACCCAACTCGATGTGCTGGAAGGTCCGGAGGGCTCTGTCTCTGGAGACGCGTTCG
CCCTGGTGCACTCGTCCCCTCTCCAACTGCCCGACCGTCGTCAAGCGCACTCCCTGGTGCAAGCGTCCCAACTCC
ATCTGCTCCAAGGTCAAGAGGTCTCTGTCTCTGGAGACGCGTTCGCCCTGGTGCACTCGTCCTCTCTCCAACTGC
CCGACCGTCGCCAAGCGCAGCCCGTGGTGCAAGCGCCCCAACTCCATCTGCTCCAAGGCCAAGAGGGCTGTCGAC
GTCTTTGCCGATACGGTCCTGCAGTCGGTGAAGCAGGACTCGGCCGCTCCCCAGACCGCCAGCGAAGCCGCCGCC
CACGATGCCGTCCTCAAACTCGCCCAGCTCGCGGCTCAGTCTAGCGAGAGCCCCGAGGATTACATCAAGTATCTC
GGCCTCGAGGACAACAAGACGGTGGCCAAGCGCGATGTCGAGAGCACCAGCGAGACGGAAGCCGAGGAGAAGGAG
GCCTGCCATGCCGAGGGCGGTGCTTGCTGGGCCGCCAAGAGGGCCGTCGATGCCGTCCTGGCAACCGTCGATGCT
GAGCAGGATGACGCCGAGGACGACGCCGAGTGCTCGCAGCGCGGAGAGGCCTGCTGGCACCAGAAGCGTCAACTC
GGAGCCCTGCGGTTCGCCGCCAACGACATCTCGTCCTCGCTGCTGTAA
Transcript >Ophun1|3828
ATGAAGTTCAACGCCATCGTCGCCATCGCCCTCGTCACGGGCGCCTCTGCCGCGCCTCAGCCCTGGTGCAAACGC
CCCAACTCCATCTGCTCCAAAGTCAAGAGGGCTGCCGATATCGTGGCCGAAGTGGCCGCTCAGGACGCCACTGCC
GAGCTCACTCACCTCCTGACGCTCTCCGAGGAAGAGCCCGAGCAGTACAGCTCCGAGGCTCTCGGCATCGACATC
GACAAGCGCTCGCCTGAGCCCTGGTGCAAGCGTCCCAATTCGCAGTGCGGCACCGCCATGGAGAAGCGCTCGCCC
ACTCCCTGGTGCAGTCGTCCCAACTCCAGCTGCCCGACCGTCGCCAAGCGCAGCCCCTGGTGCAAGCGTCCCAAT
TCCATCTGCTCCAAGGTCAAGAGGGCCGCCGATGCCGTCGTCGAAGTGGCCGCCGAGGATGCCACTGAAGAGCTC
AGCCAGCTTCTGGAGAACAACGAACAGCACTCGGAAGTCCTCGGATTCTCCGACAAGACCATGGACAAGCGCTGG
TGCACTCGTCCCCTCTCCAACTGCCCAACCAAGCGCAGCCCCTGGTGCAAGCGTCCCAACTCCATCTGCTCCAAG
GTCAAGCGCAGCCCCTGGTGCAAGCGACCCAACTCCATCTGCTCCAAGGTCAAGAGGTCTCTCGTCGAGCGCGCG
CCTGAGCCCTGGTGCCACCGACCCAACTCGATGTGCTGGAAGGTCCGGAGGGCTCTGTCTCTGGAGACGCGTTCG
CCCTGGTGCACTCGTCCCCTCTCCAACTGCCCGACCGTCGTCAAGCGCACTCCCTGGTGCAAGCGTCCCAACTCC
ATCTGCTCCAAGGTCAAGAGGTCTCTGTCTCTGGAGACGCGTTCGCCCTGGTGCACTCGTCCTCTCTCCAACTGC
CCGACCGTCGCCAAGCGCAGCCCGTGGTGCAAGCGCCCCAACTCCATCTGCTCCAAGGCCAAGAGGGCTGTCGAC
GTCTTTGCCGATACGGTCCTGCAGTCGGTGAAGCAGGACTCGGCCGCTCCCCAGACCGCCAGCGAAGCCGCCGCC
CACGATGCCGTCCTCAAACTCGCCCAGCTCGCGGCTCAGTCTAGCGAGAGCCCCGAGGATTACATCAAGTATCTC
GGCCTCGAGGACAACAAGACGGTGGCCAAGCGCGATGTCGAGAGCACCAGCGAGACGGAAGCCGAGGAGAAGGAG
GCCTGCCATGCCGAGGGCGGTGCTTGCTGGGCCGCCAAGAGGGCCGTCGATGCCGTCCTGGCAACCGTCGATGCT
GAGCAGGATGACGCCGAGGACGACGCCGAGTGCTCGCAGCGCGGAGAGGCCTGCTGGCACCAGAAGCGTCAACTC
GGAGCCCTGCGGTTCGCCGCCAACGACATCTCGTCCTCGCTGCTGTAA
Gene >Ophun1|3828
ATGAAGTTCAACGCCATCGTCGCCATCGCCCTCGTCACGGGCGCCTCTGCCGCGCCTCAGCCCTGGTGCAAACGC
CCCAACTCCATCTGCTCCAAAGTCAAGAGGGCTGCCGATATCGTGGCCGAAGTGGCCGCTCAGGACGCCACTGCC
GAGCTCACTCACCTCCTGACGCTCTCCGAGGAAGAGCCCGAGCAGTACAGCTCCGAGGCTCTCGGCATCGACATC
GACAAGCGCTCGCCTGAGCCCTGGTGCAAGCGTCCCAATTCGCAGTGCGGCACCGCCATGGAGAAGCGCTCGCCC
ACTCCCTGGTGCAGTCGTCCCAACTCCAGCTGCCCGACCGTCGCCAAGCGCAGCCCCTGGTGCAAGCGTCCCAAT
TCCATCTGCTCCAAGGTCAAGAGGGCCGCCGATGCCGTCGTCGAAGTGGCCGCCGAGGATGCCACTGAAGAGCTC
AGCCAGCTTCTGGAGAACAACGAACAGCACTCGGAAGTCCTCGGATTCTCCGACAAGACCATGGACAAGCGCTGG
TGCACTCGTCCCCTCTCCAACTGCCCAACCAAGCGCAGCCCCTGGTGCAAGCGTCCCAACTCCATCTGCTCCAAG
GTCAAGCGCAGCCCCTGGTGCAAGCGACCCAACTCCATCTGCTCCAAGGTCAAGAGGTCTCTCGTCGAGCGCGCG
CCTGAGCCCTGGTGCCACCGACCCAACTCGATGTGCTGGAAGGTCCGGAGGGCTCTGTCTCTGGAGACGCGTTCG
CCCTGGTGCACTCGTCCCCTCTCCAACTGCCCGACCGTCGTCAAGCGCACTCCCTGGTGCAAGCGTCCCAACTCC
ATCTGCTCCAAGGTCAAGAGGTCTCTGTCTCTGGAGACGCGTTCGCCCTGGTGCACTCGTCCTCTCTCCAACTGC
CCGACCGTCGCCAAGCGCAGCCCGTGGTGCAAGCGCCCCAACTCCATCTGCTCCAAGGCCAAGAGGGCTGTCGAC
GTCTTTGCCGATACGGTCCTGCAGTCGGTGAAGCAGGACTCGGCCGCTCCCCAGACCGCCAGCGAAGCCGCCGCC
CACGATGCCGTCCTCAAACTCGCCCAGCTCGCGGCTCAGTCTAGCGAGAGCCCCGAGGATTACATCAAGTATCTC
GGCCTCGAGGACAACAAGACGGTGGCCAAGCGCGATGTCGAGAGCACCAGCGAGACGGAAGCCGAGGAGAAGGAG
GCCTGCCATGCCGAGGGCGGTGCTTGCTGGGCCGCCAAGAGGGCCGTCGATGCCGTCCTGGCAACCGTCGATGCT
GAGCAGGATGACGCCGAGGACGACGCCGAGTGCTCGCAGCGCGGAGAGGCCTGCTGGCACCAGAAGCGTCAACTC
GGAGCCCTGCGGTTCGCCGCCAACGACATCTCGTCCTCGCTGCTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail