Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3826
Gene name
LocationContig_344:327..4344
Strand-
Gene length (bp)4017
Transcript length (bp)3201
Coding sequence length (bp)3201
Protein length (aa) 1067

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07364 DUF1485 Metallopeptidase family M81 2.9E-98 526 815
PF00067 p450 Cytochrome P450 5.2E-77 55 506
PF07171 MlrC_C MlrC C-terminus 5.7E-56 826 997

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P17549|CP53_ASPNG Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 30 515 8.0E-151
sp|Q12608|STCB_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 31 482 2.0E-43
sp|P38364|PID6_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 12 473 1.0E-39
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 12 473 1.0E-38
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 31 487 2.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P17549|CP53_ASPNG Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 30 515 8.0E-151
sp|Q12608|STCB_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 31 482 2.0E-43
sp|P38364|PID6_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 12 473 1.0E-39
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 12 473 1.0E-38
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 31 487 2.0E-38
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 31 487 1.0E-35
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 31 487 1.0E-35
sp|O13317|TRI11_FUSSP Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 64 487 9.0E-33
sp|O00061|CP67_UROFA Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 25 478 1.0E-30
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 8 497 2.0E-30
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 33 505 7.0E-30
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 8 502 7.0E-30
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 123 499 1.0E-28
sp|Q12609|STCF_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 60 476 1.0E-28
sp|Q09653|C13AA_CAEEL Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 11 497 2.0E-28
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 8 497 2.0E-28
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 8 505 3.0E-28
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 8 499 4.0E-28
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 123 505 5.0E-28
sp|Q12732|AVNA_ASPPA Averantin hydroxylase OS=Aspergillus parasiticus GN=avnA PE=1 SV=2 49 476 2.0E-27
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 123 506 2.0E-27
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 8 497 2.0E-27
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 8 511 2.0E-27
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 63 497 2.0E-27
sp|Q27520|C13A1_CAEEL Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 7 497 3.0E-27
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 8 497 3.0E-27
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 8 497 7.0E-27
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 8 497 1.0E-26
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 33 502 1.0E-26
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 156 499 2.0E-26
sp|Q27513|C13A4_CAEEL Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 87 497 4.0E-26
sp|Q27519|C13A7_CAEEL Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 167 492 5.0E-26
sp|Q9LUC5|C7A15_ARATH Cytochrome P450 72A15 OS=Arabidopsis thaliana GN=CYP72A15 PE=2 SV=1 78 485 7.0E-26
sp|Q27515|C13A6_CAEEL Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 304 497 1.0E-25
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 123 497 1.0E-25
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 267 497 1.0E-25
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 8 493 2.0E-25
sp|Q9LUC8|C7A13_ARATH Cytochrome P450 72A13 OS=Arabidopsis thaliana GN=CYP72A13 PE=2 SV=1 78 485 3.0E-25
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 8 497 4.0E-25
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 8 505 6.0E-25
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 156 500 6.0E-25
sp|Q27517|C13A3_CAEEL Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 123 497 8.0E-25
sp|Q27514|C13A5_CAEEL Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 305 497 1.0E-24
sp|Q27516|C13A8_CAEEL Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 185 497 2.0E-24
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 298 505 2.0E-24
sp|P33269|CP4D1_DROME Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 115 486 1.0E-23
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 8 497 1.0E-23
sp|Q00707|STCL_EMENI Versicolorin B desaturase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcL PE=1 SV=2 11 478 1.0E-23
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 311 497 2.0E-23
sp|Q93CA6|MLRC_SPHSX Microcystinase C (Fragment) OS=Sphingomonas sp. GN=mlrC PE=3 SV=1 571 1006 2.0E-23
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 59 490 2.0E-23
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 272 510 5.0E-23
sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 78 485 5.0E-23
sp|Q9LUC6|C7A14_ARATH Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 78 485 6.0E-23
sp|Q9UW95|AFLL_ASPPA Versicolorin B desaturase OS=Aspergillus parasiticus GN=verB PE=3 SV=1 11 478 6.0E-23
sp|O17624|C13B1_CAEEL Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 305 493 6.0E-23
sp|O16805|CP4D1_DROSI Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 115 486 7.0E-23
sp|P14779|CPXB_BACME Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 287 504 8.0E-23
sp|H2DH21|C7A29_PANGI Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1 122 485 1.0E-22
sp|H1A988|C7254_GLYUR 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 122 485 2.0E-22
sp|Q964R1|CP6J1_BLAGE Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 184 492 2.0E-22
sp|O08336|CYPB_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 285 560 3.0E-22
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 287 493 3.0E-22
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 287 493 4.0E-22
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 122 488 5.0E-22
sp|O42563|CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 288 514 5.0E-22
sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 78 484 5.0E-22
sp|Q9LUC9|C7A11_ARATH Cytochrome P450 72A11 OS=Arabidopsis thaliana GN=CYP72A11 PE=2 SV=1 122 485 6.0E-22
sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 115 514 2.0E-21
sp|O08394|CYPD_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=1 SV=1 170 514 2.0E-21
sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 125 502 2.0E-21
sp|Q12612|TRI4_FUSSP Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 31 486 3.0E-21
sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 115 514 4.0E-21
sp|Q07973|CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 137 487 5.0E-21
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 287 488 6.0E-21
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 288 488 6.0E-21
sp|Q9EP75|CP4FE_MOUSE Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 101 488 7.0E-21
sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 124 515 8.0E-21
sp|P08682|CP2E1_RABIT Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 227 514 1.0E-20
sp|Q64441|CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 29 486 1.0E-20
sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 124 514 1.0E-20
sp|P08516|CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 263 488 1.0E-20
sp|Q9VS79|CP4D8_DROME Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 288 515 2.0E-20
sp|P51869|CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 288 488 3.0E-20
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 288 488 3.0E-20
sp|P29980|CPXN_NOSS1 Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 287 519 3.0E-20
sp|Q8SPK1|CP4AO_PIG Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 287 488 3.0E-20
sp|Q9GJX5|CP4AL_PIG Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 286 488 4.0E-20
sp|Q964T1|CP4CU_BLAGE Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 78 506 4.0E-20
sp|Q9V7G5|C4AA1_DROME Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 82 495 7.0E-20
sp|Q27518|C13A2_CAEEL Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 174 485 8.0E-20
sp|Q08477|CP4F3_HUMAN Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 122 488 9.0E-20
sp|O88833|CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 263 523 1.0E-19
sp|P82712|CCD1P_DROME Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 171 504 1.0E-19
sp|Q9VYQ7|CP311_DROME Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 103 486 2.0E-19
sp|Q50EK4|C75A1_PINTA Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 243 478 2.0E-19
sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 288 488 2.0E-19
sp|Q7KR10|CCD1D_DROME Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 171 504 3.0E-19
sp|F4IK45|C70B2_ARATH Cytochrome P450 709B2 OS=Arabidopsis thaliana GN=CYP709B2 PE=2 SV=1 299 484 3.0E-19
sp|P49430|THAS_RAT Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 304 493 4.0E-19
sp|Q9VCW1|CP6D4_DROME Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 175 493 4.0E-19
sp|Q4G0S4|C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 219 495 5.0E-19
sp|P14581|CP4A7_RABIT Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 287 488 5.0E-19
sp|Q9VL92|CP4E3_DROME Cytochrome P450 4e3 OS=Drosophila melanogaster GN=Cyp4e3 PE=2 SV=1 76 501 5.0E-19
sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 93 490 7.0E-19
sp|P14580|CP4A6_RABIT Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 287 488 7.0E-19
sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 275 475 7.0E-19
sp|P20816|CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 256 488 8.0E-19
sp|Q6NT55|CP4FN_HUMAN Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 288 484 8.0E-19
sp|P00184|CP1A1_MOUSE Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1 SV=2 112 508 8.0E-19
sp|Q9ZW95|C7352_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A2 PE=1 SV=1 301 485 1.0E-18
sp|P05176|CP1A1_RABIT Cytochrome P450 1A1 OS=Oryctolagus cuniculus GN=CYP1A1 PE=2 SV=1 252 516 1.0E-18
sp|Q9SHG5|C72C1_ARATH Cytochrome P450 72C1 OS=Arabidopsis thaliana GN=CYP72C1 PE=2 SV=2 287 486 1.0E-18
sp|Q99N16|CP4F3_MOUSE Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 288 488 1.0E-18
sp|H2DH17|C7A22_PANGI Cytochrome P450 CYP749A22 OS=Panax ginseng PE=2 SV=1 122 485 1.0E-18
sp|P56590|CP1A1_CANLF Cytochrome P450 1A1 OS=Canis lupus familiaris GN=CYP1A1 PE=2 SV=1 218 510 1.0E-18
sp|Q09128|CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 135 486 1.0E-18
sp|Q3LFT9|CP1A2_BALAC Cytochrome P450 1A2 OS=Balaenoptera acutorostrata GN=CYP1A2 PE=2 SV=3 112 516 2.0E-18
sp|Q64462|CP4B1_MOUSE Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 286 488 2.0E-18
sp|P05177|CP1A2_HUMAN Cytochrome P450 1A2 OS=Homo sapiens GN=CYP1A2 PE=1 SV=3 58 514 2.0E-18
sp|Q02928|CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 287 488 2.0E-18
sp|P20817|CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 256 488 2.0E-18
sp|Q9HCS2|CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 288 478 2.0E-18
sp|P33266|CP2E1_MACFA Cytochrome P450 2E1 (Fragment) OS=Macaca fascicularis GN=CYP2E1 PE=2 SV=1 224 514 3.0E-18
sp|H1A981|C7263_MEDTR 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 78 485 3.0E-18
sp|Q9VVR9|C12C1_DROME Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 167 504 4.0E-18
sp|P00185|CP1A1_RAT Cytochrome P450 1A1 OS=Rattus norvegicus GN=Cyp1a1 PE=1 SV=1 112 508 4.0E-18
sp|P51589|CP2J2_HUMAN Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 165 488 5.0E-18
sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 262 475 5.0E-18
sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 267 484 5.0E-18
sp|Q91WL5|CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 291 488 6.0E-18
sp|Q9ZUX1|C94C1_ARATH Cytochrome P450 94C1 OS=Arabidopsis thaliana GN=CYP94C1 PE=2 SV=1 246 487 6.0E-18
sp|O44221|CP4E5_DROMT Cytochrome P450 4e5, mitochondrial OS=Drosophila mettleri GN=Cyp4e5 PE=2 SV=1 98 515 7.0E-18
sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 122 488 7.0E-18
sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 172 487 8.0E-18
sp|Q9Y758|CP52M_DEBHN Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 184 476 8.0E-18
sp|Q6R7M4|C15A1_DIPPU Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 291 500 9.0E-18
sp|O35728|CP4AE_MOUSE Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 263 488 1.0E-17
sp|Q9ASR3|C7091_ARATH Cytochrome P450 709B1 OS=Arabidopsis thaliana GN=CYP709B1 PE=2 SV=1 165 484 1.0E-17
sp|P36423|THAS_MOUSE Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 304 493 1.0E-17
sp|Q5TCH4|CP4AM_HUMAN Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 287 488 1.0E-17
sp|O18596|C4D10_DROMT Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 288 514 1.0E-17
sp|Q9VB31|C6A18_DROME Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 275 492 2.0E-17
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 288 488 2.0E-17
sp|O46051|C4D14_DROME Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 67 516 2.0E-17
sp|Q6GUQ4|CP2E1_MACMU Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 234 514 2.0E-17
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 304 493 2.0E-17
sp|P24464|CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 287 488 2.0E-17
sp|B5BSX1|BAMO_GLYUR Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 256 484 2.0E-17
sp|P52786|CP2J1_RABIT Cytochrome P450 2J1 OS=Oryctolagus cuniculus GN=CYP2J1 PE=1 SV=2 167 488 2.0E-17
sp|P13584|CP4B1_HUMAN Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 286 484 3.0E-17
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 291 488 3.0E-17
sp|H2DH24|C7D47_PANGI Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 274 479 3.0E-17
sp|Q59990|CP120_SYNY3 Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 221 484 3.0E-17
sp|P05181|CP2E1_HUMAN Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 234 495 4.0E-17
sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 287 501 4.0E-17
sp|P15128|CP4B1_RABIT Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 78 489 6.0E-17
sp|P14579|CP4A5_RABIT Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 287 488 7.0E-17
sp|O77810|CP1A2_CALJA Cytochrome P450 1A2 OS=Callithrix jacchus GN=CYP1A2 PE=2 SV=3 113 516 7.0E-17
sp|Q64429|CP1B1_MOUSE Cytochrome P450 1B1 OS=Mus musculus GN=Cyp1b1 PE=1 SV=3 224 483 7.0E-17
sp|Q2PG45|THAS_MACFA Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 304 493 7.0E-17
sp|Q9V4T5|CP4E1_DROME Probable cytochrome P450 4e1 OS=Drosophila melanogaster GN=Cyp4e1 PE=2 SV=1 98 501 8.0E-17
sp|Q9VE01|C12A5_DROME Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 287 504 1.0E-16
sp|P10611|CP4A4_RABIT Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 287 488 1.0E-16
sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 267 479 1.0E-16
sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 249 484 1.0E-16
sp|Q27606|CP4E2_DROME Cytochrome P450 4e2 OS=Drosophila melanogaster GN=Cyp4e2 PE=2 SV=2 115 501 1.0E-16
sp|O49342|C71AD_ARATH Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 291 469 1.0E-16
sp|Q00557|CP1A1_MESAU Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP1A1 PE=2 SV=2 140 508 1.0E-16
sp|B9DFU2|MAX1_ARATH Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 143 493 1.0E-16
sp|O18963|CP2E1_BOVIN Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1 165 514 2.0E-16
sp|Q5RBQ1|CP1A2_PONAB Cytochrome P450 1A2 OS=Pongo abelii GN=CYP1A2 PE=2 SV=3 29 516 2.0E-16
sp|P24903|CP2F1_HUMAN Cytochrome P450 2F1 OS=Homo sapiens GN=CYP2F1 PE=1 SV=2 292 495 3.0E-16
sp|E3W9C4|C71A1_ZINZE Alpha-humulene 10-hydroxylase OS=Zingiber zerumbet GN=CYP71BA1 PE=1 SV=1 292 465 3.0E-16
sp|Q9K498|EIZFM_STRCO Epi-isozizaene 5-monooxygenase/(E)-beta-farnesene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5223 PE=1 SV=1 243 504 3.0E-16
sp|P13108|CP2D4_RAT Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2 280 485 3.0E-16
sp|Q5KQT7|CP1A1_FELCA Cytochrome P450 1A1 OS=Felis catus GN=CYP1A1 PE=2 SV=1 218 478 3.0E-16
sp|Q00714|STCS_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcS OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcS PE=1 SV=2 300 488 3.0E-16
sp|O77809|CP1A2_MACFA Cytochrome P450 1A2 OS=Macaca fascicularis GN=CYP1A2 PE=1 SV=3 113 516 3.0E-16
sp|Q9T093|C70B3_ARATH Cytochrome P450 709B3 OS=Arabidopsis thaliana GN=CYP709B3 PE=2 SV=1 123 486 3.0E-16
sp|Q964T2|CP9E2_BLAGE Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 308 500 4.0E-16
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 304 493 4.0E-16
sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 303 515 5.0E-16
sp|P33272|CP2BC_RAT Cytochrome P450 2B12 OS=Rattus norvegicus GN=Cyp2b12 PE=2 SV=1 259 486 5.0E-16
sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 282 486 5.0E-16
sp|Q9VE00|C12A4_DROME Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 287 504 5.0E-16
sp|P04798|CP1A1_HUMAN Cytochrome P450 1A1 OS=Homo sapiens GN=CYP1A1 PE=1 SV=1 252 483 5.0E-16
sp|P15129|CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 286 484 6.0E-16
sp|P00187|CP1A2_RABIT Cytochrome P450 1A2 OS=Oryctolagus cuniculus GN=CYP1A2 PE=1 SV=3 173 516 6.0E-16
sp|Q9Y6A2|CP46A_HUMAN Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 123 487 6.0E-16
sp|H2DH18|C7A12_PANGI Cytochrome P450 CYP736A12 OS=Panax ginseng PE=2 SV=1 298 478 7.0E-16
sp|P93147|C81E1_GLYEC Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 152 481 7.0E-16
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 287 488 8.0E-16
sp|Q3LFU0|CP1A1_BALAC Cytochrome P450 1A1 OS=Balaenoptera acutorostrata GN=CYP1A1 PE=2 SV=1 112 487 8.0E-16
sp|P51590|CP2J3_RAT Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 280 488 8.0E-16
sp|Q9V4U7|C6A14_DROME Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 288 484 9.0E-16
sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 267 479 1.0E-15
sp|Q9V559|CP4P3_DROME Probable cytochrome P450 4p3 OS=Drosophila melanogaster GN=Cyp4p3 PE=2 SV=3 79 515 1.0E-15
sp|Q64678|CP1B1_RAT Cytochrome P450 1B1 OS=Rattus norvegicus GN=Cyp1b1 PE=1 SV=1 224 483 1.0E-15
sp|O35293|CP2F2_RAT Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 276 495 1.0E-15
sp|Q96581|C75A4_GENTR Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1 287 500 1.0E-15
sp|Q9LHA1|C8D11_ARATH Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 320 479 1.0E-15
sp|P56591|CP1A1_SHEEP Cytochrome P450 1A1 OS=Ovis aries GN=CYP1A1 PE=2 SV=1 113 478 1.0E-15
sp|O18809|CP2F3_CAPHI Cytochrome P450 2F3 OS=Capra hircus GN=CYP2F3 PE=2 SV=1 234 495 1.0E-15
sp|O35084|CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 307 488 1.0E-15
sp|Q64680|CP2DI_RAT Cytochrome P450 2D18 OS=Rattus norvegicus GN=Cyp2d18 PE=2 SV=1 280 485 1.0E-15
sp|Q9FVS9|C96AF_ARATH Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 243 487 2.0E-15
sp|O46054|C4AE1_DROME Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 303 497 2.0E-15
sp|Q42569|C90A1_ARATH Cytochrome P450 90A1 OS=Arabidopsis thaliana GN=CYP90A1 PE=2 SV=1 252 518 2.0E-15
sp|P19225|CP270_RAT Cytochrome P450 2C70 OS=Rattus norvegicus GN=Cyp2c70 PE=2 SV=1 219 504 2.0E-15
sp|Q9VXY0|CP4S3_DROME Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 78 488 2.0E-15
sp|P17666|CP2CE_RABIT Cytochrome P450 2C14 OS=Oryctolagus cuniculus GN=CYP2C14 PE=2 SV=1 245 495 2.0E-15
sp|O23066|C86A2_ARATH Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=1 SV=1 269 479 2.0E-15
sp|Q9VQD2|CP391_DROME Probable cytochrome P450 309a1 OS=Drosophila melanogaster GN=Cyp309a1 PE=1 SV=4 287 491 2.0E-15
sp|Q9VHP4|CP313_DROME Probable cytochrome P450 313b1 OS=Drosophila melanogaster GN=Cyp313b1 PE=2 SV=2 80 499 2.0E-15
sp|Q8WNE1|CP2F5_GORGO Cytochrome P450 2F5 OS=Gorilla gorilla gorilla GN=CYP2F5 PE=3 SV=2 292 495 2.0E-15
sp|Q54CS3|C508C_DICDI Probable cytochrome P450 508C1 OS=Dictyostelium discoideum GN=cyp508C1 PE=3 SV=1 279 493 3.0E-15
sp|Q9FG65|C81D1_ARATH Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 320 499 3.0E-15
sp|Q27593|CP6A8_DROME Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 288 492 3.0E-15
sp|Q9QYG6|CP2DR_MESAU Cytochrome P450 2D27 OS=Mesocricetus auratus GN=CYP2D27 PE=1 SV=1 276 505 3.0E-15
sp|P30612|CP52P_CANTR Cytochrome P450 52C1 OS=Candida tropicalis GN=CYP52C1 PE=2 SV=1 293 477 3.0E-15
sp|P56593|CP2AC_MOUSE Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=2 252 502 3.0E-15
sp|Q9WVK8|CP46A_MOUSE Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 291 487 3.0E-15
sp|O18635|C12A2_MUSDO Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 255 504 4.0E-15
sp|Q9SBQ9|F3PH_PETHY Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 290 478 4.0E-15
sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 287 484 4.0E-15
sp|Q9V8M2|C12B2_DROME Probable cytochrome P450 12b2, mitochondrial OS=Drosophila melanogaster GN=Cyp12b2 PE=2 SV=2 291 492 4.0E-15
sp|Q4H4C3|CP1A2_MACFU Cytochrome P450 1A2 OS=Macaca fuscata fuscata GN=CYP1A2 PE=2 SV=3 113 516 4.0E-15
sp|Q9VVN6|CP312_DROME Probable cytochrome P450 312a1 OS=Drosophila melanogaster GN=Cyp312a1 PE=2 SV=1 292 515 4.0E-15
sp|Q9QYG5|CP2DK_MESAU Cytochrome P450 2D20 OS=Mesocricetus auratus GN=CYP2D20 PE=2 SV=1 276 505 4.0E-15
sp|Q1ZXF5|C5084_DICDI Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 273 514 5.0E-15
sp|Q6TBX7|LUT1_ARATH Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 274 486 5.0E-15
sp|P00182|CP2C3_RABIT Cytochrome P450 2C3 OS=Oryctolagus cuniculus GN=CYP2C3 PE=1 SV=2 219 511 6.0E-15
sp|P13107|CP2B3_RAT Cytochrome P450 2B3 OS=Rattus norvegicus GN=Cyp2b3 PE=2 SV=1 320 486 6.0E-15
sp|Q9V674|CP6G1_DROME Cytochrome P450 6g1 OS=Drosophila melanogaster GN=Cyp6g1 PE=2 SV=1 258 497 6.0E-15
sp|O54750|CP2J6_MOUSE Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 280 488 6.0E-15
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 298 469 6.0E-15
sp|Q64391|CP1A2_CAVPO Cytochrome P450 1A2 OS=Cavia porcellus GN=CYP1A2 PE=2 SV=1 252 516 6.0E-15
sp|Q01361|CP2DE_BOVIN Cytochrome P450 2D14 OS=Bos taurus GN=CYP2D14 PE=2 SV=2 273 485 7.0E-15
sp|O55071|CP2BJ_MOUSE Cytochrome P450 2B19 OS=Mus musculus GN=Cyp2b19 PE=2 SV=1 254 486 7.0E-15
sp|O54749|CP2J5_MOUSE Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 280 488 8.0E-15
sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 264 495 8.0E-15
sp|P51581|CP2E1_MESAU Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP2E1 PE=2 SV=1 227 495 9.0E-15
sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 264 484 9.0E-15
sp|Q96418|C75A5_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A5 PE=2 SV=1 291 476 1.0E-14
sp|Q9VMS9|C4AC1_DROME Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 288 514 1.0E-14
sp|P05180|CP2H1_CHICK Cytochrome P450 2H1 OS=Gallus gallus GN=CYP2H1 PE=2 SV=1 218 495 1.0E-14
sp|P48422|C86A1_ARATH Cytochrome P450 86A1 OS=Arabidopsis thaliana GN=CYP86A1 PE=1 SV=2 291 489 1.0E-14
sp|P00176|CP2B1_RAT Cytochrome P450 2B1 OS=Rattus norvegicus GN=Cyp2b1 PE=1 SV=1 254 486 1.0E-14
sp|Q6VVX0|CP2R1_HUMAN Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1 PE=1 SV=1 293 487 1.0E-14
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 266 469 1.0E-14
sp|B9G934|C14C3_ORYSJ Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 317 488 1.0E-14
sp|P00181|CP2C2_RABIT Cytochrome P450 2C2 OS=Oryctolagus cuniculus GN=CYP2C2 PE=1 SV=2 292 507 1.0E-14
sp|P20678|CP2H2_CHICK Cytochrome P450 2H2 OS=Gallus gallus GN=CYP2H2 PE=1 SV=1 218 495 1.0E-14
sp|Q556M4|C5082_DICDI Probable cytochrome P450 508A2 OS=Dictyostelium discoideum GN=cyp508A2-1 PE=3 SV=1 269 515 1.0E-14
sp|Q6GUR1|CP1A1_MACMU Cytochrome P450 1A1 OS=Macaca mulatta GN=CYP1A1 PE=2 SV=1 252 488 1.0E-14
sp|Q82IY3|PTLI_STRAW Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 288 486 1.0E-14
sp|O15528|CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 307 488 2.0E-14
sp|P33270|CP6A2_DROME Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 288 497 2.0E-14
sp|Q64403|CP2DG_CAVPO Cytochrome P450 2D16 OS=Cavia porcellus GN=CYP2D16 PE=1 SV=1 281 485 2.0E-14
sp|P33616|CP1A1_MACFA Cytochrome P450 1A1 OS=Macaca fascicularis GN=CYP1A1 PE=2 SV=1 252 488 2.0E-14
sp|Q42798|C93A1_SOYBN 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 258 469 2.0E-14
sp|D5JBW8|GAO_CICIN Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 291 475 2.0E-14
sp|P10634|CP2DQ_RAT Cytochrome P450 2D26 OS=Rattus norvegicus GN=Cyp2d26 PE=1 SV=2 276 490 2.0E-14
sp|Q8K0C4|CP51A_MOUSE Lanosterol 14-alpha demethylase OS=Mus musculus GN=Cyp51a1 PE=1 SV=1 246 484 2.0E-14
sp|P24460|CP2BB_CANLF Cytochrome P450 2B11 OS=Canis lupus familiaris GN=CYP2B11 PE=2 SV=1 267 490 2.0E-14
sp|Q9V770|C6A17_DROME Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 263 497 2.0E-14
sp|P00180|CP2C1_RABIT Cytochrome P450 2C1 OS=Oryctolagus cuniculus GN=CYP2C1 PE=1 SV=2 292 495 2.0E-14
sp|Q92113|CP17A_SQUAC Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 322 515 2.0E-14
sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 300 487 3.0E-14
sp|P33267|CP2F2_MOUSE Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=1 SV=1 234 495 3.0E-14
sp|Q9V771|C6A23_DROME Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 267 497 3.0E-14
sp|P13527|CP6A1_MUSDO Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 167 493 3.0E-14
sp|P05182|CP2E1_RAT Cytochrome P450 2E1 OS=Rattus norvegicus GN=Cyp2e1 PE=1 SV=4 291 495 3.0E-14
sp|P9WPM9|C135B_MYCTU Putative cytochrome P450 135B1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp135B1 PE=1 SV=1 282 483 3.0E-14
sp|P9WPM8|C135B_MYCTO Putative cytochrome P450 135B1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp135B1 PE=3 SV=1 282 483 3.0E-14
sp|P63716|C135B_MYCBO Putative cytochrome P450 135B1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp135B1 PE=3 SV=1 282 483 3.0E-14
sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 320 469 3.0E-14
sp|O64637|C76C2_ARATH Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 262 479 3.0E-14
sp|O44220|C12B1_DROAC Cytochrome P450 12b1, mitochondrial OS=Drosophila acanthoptera GN=Cyp12b1 PE=2 SV=1 103 491 4.0E-14
sp|Q556M5|C5081_DICDI Probable cytochrome P450 508A1 OS=Dictyostelium discoideum GN=cyp508A1-1 PE=3 SV=1 274 514 4.0E-14
sp|Q9VYT8|C28C1_DROME Probable cytochrome P450 28c1 OS=Drosophila melanogaster GN=Cyp28c1 PE=2 SV=1 235 465 4.0E-14
sp|P48419|C75A3_PETHY Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1 291 514 4.0E-14
sp|P04167|CP2B2_RAT Cytochrome P450 2B2 OS=Rattus norvegicus GN=Cyp2b2 PE=1 SV=2 254 486 4.0E-14
sp|Q9FMY1|C86B1_ARATH Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 274 487 4.0E-14
sp|Q9V9L1|CP6W1_DROME Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 187 475 4.0E-14
sp|Q6WNQ8|C81E8_MEDTR Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1 320 470 4.0E-14
sp|Q9V773|C6A20_DROME Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 288 473 5.0E-14
sp|P12938|CP2D3_RAT Cytochrome P450 2D3 OS=Rattus norvegicus GN=Cyp2d3 PE=2 SV=2 276 485 5.0E-14
sp|D4AY62|A1131_ARTBC Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 312 493 5.0E-14
sp|Q9VFJ0|CA131_DROME Probable cytochrome P450 313a1 OS=Drosophila melanogaster GN=Cyp313a1 PE=3 SV=2 144 486 5.0E-14
sp|P12790|CP2B9_MOUSE Cytochrome P450 2B9 OS=Mus musculus GN=Cyp2b9 PE=1 SV=2 254 486 5.0E-14
sp|Q9QUJ1|CP2DS_MESAU Cytochrome P450 2D28 OS=Mesocricetus auratus GN=CYP2D28A PE=2 SV=1 280 485 6.0E-14
sp|Q42716|C71A8_MENPI Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 275 465 6.0E-14
sp|Q9VMS8|C4AC2_DROME Probable cytochrome P450 4ac2 OS=Drosophila melanogaster GN=Cyp4ac2 PE=2 SV=4 287 515 6.0E-14
sp|B9GBJ9|C14C1_ORYSJ Cytochrome P450 714C1 OS=Oryza sativa subsp. japonica GN=CYP714C1 PE=2 SV=1 371 488 6.0E-14
sp|Q9SAB6|C71AI_ARATH Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 297 484 6.0E-14
sp|F2Z9C1|P6H_ESCCA Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 291 491 6.0E-14
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 307 486 6.0E-14
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 277 484 7.0E-14
sp|P58046|C71AF_ARATH Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 275 487 7.0E-14
sp|O49340|C71AC_ARATH Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1 320 487 7.0E-14
sp|Q6YTF5|C76M5_ORYSJ Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 322 487 7.0E-14
sp|O04790|C75A7_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A7 PE=2 SV=1 301 476 7.0E-14
sp|P11711|CP2A1_RAT Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 252 487 7.0E-14
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 172 486 7.0E-14
sp|O23051|KAO1_ARATH Ent-kaurenoic acid oxidase 1 OS=Arabidopsis thaliana GN=KAO1 PE=2 SV=1 267 487 7.0E-14
sp|P10632|CP2C8_HUMAN Cytochrome P450 2C8 OS=Homo sapiens GN=CYP2C8 PE=1 SV=2 292 495 8.0E-14
sp|Q2KIG5|THAS_BOVIN Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=2 SV=1 304 465 8.0E-14
sp|Q9FF18|C7351_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A1 PE=1 SV=1 315 484 8.0E-14
sp|E9Q816|CP2W1_MOUSE Cytochrome P450 2W1 OS=Mus musculus GN=Cyp2w1 PE=2 SV=1 286 488 9.0E-14
sp|Q29488|CP2DH_MACFA Cytochrome P450 2D17 OS=Macaca fascicularis GN=CYP2D17 PE=2 SV=1 280 485 9.0E-14
sp|Q64654|CP51A_RAT Lanosterol 14-alpha demethylase OS=Rattus norvegicus GN=Cyp51a1 PE=2 SV=1 246 484 1.0E-13
sp|Q0IIF9|CP2U1_BOVIN Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 298 514 1.0E-13
sp|Q5KQT6|CP1A2_FELCA Cytochrome P450 1A2 OS=Felis catus GN=CYP1A2 PE=2 SV=1 187 516 1.0E-13
sp|P10615|CP52A_CANTR Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 214 485 1.0E-13
sp|Q16678|CP1B1_HUMAN Cytochrome P450 1B1 OS=Homo sapiens GN=CYP1B1 PE=1 SV=2 274 487 1.0E-13
sp|O46420|CP51A_PIG Lanosterol 14-alpha demethylase OS=Sus scrofa GN=CYP51A1 PE=2 SV=1 246 484 1.0E-13
sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 291 484 1.0E-13
sp|Q43246|C88A1_MAIZE Cytochrome P450 88A1 OS=Zea mays GN=CYP88A1 PE=2 SV=1 291 513 1.0E-13
sp|Q02318|CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 307 492 1.0E-13
sp|Q9CAD6|C86A7_ARATH Cytochrome P450 86A7 OS=Arabidopsis thaliana GN=CYP86A7 PE=2 SV=1 291 484 1.0E-13
sp|Q9VMS7|C4AC3_DROME Probable cytochrome P450 4ac3 OS=Drosophila melanogaster GN=Cyp4ac3 PE=2 SV=2 287 499 1.0E-13
sp|Q9MZY0|CP2E1_CANLF Cytochrome P450 2E1 OS=Canis lupus familiaris GN=CYP2E1 PE=2 SV=1 165 495 1.0E-13
sp|P58047|C71AS_ARATH Putative cytochrome P450 71A28 OS=Arabidopsis thaliana GN=CYP71A28 PE=3 SV=2 335 499 2.0E-13
sp|Q64410|CP17A_CAVPO Steroid 17-alpha-hydroxylase/17,20 lyase OS=Cavia porcellus GN=CYP17A1 PE=1 SV=1 299 511 2.0E-13
sp|Q964R0|CP6K1_BLAGE Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6K1 PE=2 SV=1 311 492 2.0E-13
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 172 488 2.0E-13
sp|O65012|C78A4_PINRA Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1 287 491 2.0E-13
sp|Q9Y757|CP52L_DEBHN Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 262 484 2.0E-13
sp|P11715|CP17A_RAT Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 245 513 2.0E-13
sp|Q06367|CP1A1_CAVPO Cytochrome P450 1A1 OS=Cavia porcellus GN=CYP1A1 PE=1 SV=1 322 478 2.0E-13
sp|P37120|C75A2_SOLME Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1 291 476 2.0E-13
sp|P12394|CP17A_CHICK Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 290 486 2.0E-13
sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 265 469 2.0E-13
sp|P24456|CP2DA_MOUSE Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE=1 SV=2 280 485 2.0E-13
sp|Q2XNC8|CP2D6_PANTR Cytochrome P450 2D6 OS=Pan troglodytes GN=CYP2D6 PE=3 SV=1 280 485 3.0E-13
sp|P17178|CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 307 486 3.0E-13
sp|D5JBX0|GAO_HELAN Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 291 475 3.0E-13
sp|P82713|CP392_DROME Probable cytochrome P450 309a2 OS=Drosophila melanogaster GN=Cyp309a2 PE=2 SV=2 263 474 3.0E-13
sp|Q9STL0|C71AN_ARATH Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 165 469 3.0E-13
sp|Q8CIM7|CP2DQ_MOUSE Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE=1 SV=1 280 485 3.0E-13
sp|Q9GMC8|CP17A_FELCA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1 299 484 3.0E-13
sp|Q948Y1|C719A_COPJA (S)-canadine synthase OS=Coptis japonica GN=CYP719A1 PE=1 SV=1 254 472 3.0E-13
sp|Q29510|CP2CU_RABIT Cytochrome P450 2C30 OS=Oryctolagus cuniculus GN=CYP2C30 PE=2 SV=1 322 511 3.0E-13
sp|Q9YH64|CP1A1_PLAFE Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a1 PE=3 SV=1 252 489 3.0E-13
sp|Q9LMM1|C86A4_ARATH Cytochrome P450 86A4 OS=Arabidopsis thaliana GN=CYP86A4 PE=1 SV=1 184 479 3.0E-13
sp|P16496|CP52C_CANMA Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 263 484 3.0E-13
sp|P10635|CP2D6_HUMAN Cytochrome P450 2D6 OS=Homo sapiens GN=CYP2D6 PE=1 SV=2 280 485 3.0E-13
sp|P82711|C6A19_DROME Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 289 473 3.0E-13
sp|P9WPN2|CP132_MYCTO Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp132 PE=3 SV=1 291 484 3.0E-13
sp|P59954|CP132_MYCBO Putative cytochrome P450 132 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp132 PE=3 SV=1 291 484 3.0E-13
sp|P24457|CP2DB_MOUSE Cytochrome P450 2D11 OS=Mus musculus GN=Cyp2d11 PE=2 SV=2 280 486 3.0E-13
sp|Q964Q7|CP6D3_MUSDO Cytochrome P450 6d3 OS=Musca domestica GN=CYP6D3 PE=2 SV=1 175 517 3.0E-13
sp|P9WPN3|CP132_MYCTU Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp132 PE=1 SV=1 291 484 3.0E-13
sp|P11714|CP2D9_MOUSE Cytochrome P450 2D9 OS=Mus musculus GN=Cyp2d9 PE=1 SV=2 251 485 3.0E-13
sp|Q50EK3|C04C1_PINTA Cytochrome P450 704C1 OS=Pinus taeda GN=CYP704C1 PE=2 SV=1 289 493 3.0E-13
sp|Q64583|CP2BF_RAT Cytochrome P450 2B15 OS=Rattus norvegicus GN=Cyp2b15 PE=3 SV=2 254 486 3.0E-13
sp|Q9C788|C70B1_ARATH Cytochrome P450 704B1 OS=Arabidopsis thaliana GN=CYP704B1 PE=1 SV=1 94 484 4.0E-13
sp|O35132|CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 307 488 4.0E-13
sp|Q16850|CP51A_HUMAN Lanosterol 14-alpha demethylase OS=Homo sapiens GN=CYP51A1 PE=1 SV=3 246 484 4.0E-13
sp|Q27594|CP6A9_DROME Cytochrome P450 6a9 OS=Drosophila melanogaster GN=Cyp6a9 PE=2 SV=3 288 492 4.0E-13
sp|Q078T0|PHACB_EMEND 3-hydroxyphenylacetate 6-hydroxylase OS=Emericella nidulans GN=phacB PE=1 SV=1 301 491 4.0E-13
sp|Q54NY3|C554A_DICDI Probable cytochrome P450 554A1 OS=Dictyostelium discoideum GN=cyp554A1 PE=3 SV=1 220 484 4.0E-13
sp|Q2XNC9|CP2D6_PANPA Cytochrome P450 2D6 OS=Pan paniscus GN=CYP2D6 PE=3 SV=1 280 485 4.0E-13
sp|O42457|CP1A1_SPAAU Cytochrome P450 1A1 OS=Sparus aurata GN=cyp1a1 PE=2 SV=1 252 514 4.0E-13
sp|P33262|CP2CK_MACFA Cytochrome P450 2C20 OS=Macaca fascicularis GN=CYP2C20 PE=2 SV=1 292 495 4.0E-13
sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 320 520 5.0E-13
sp|Q27712|CP2L1_PANAR Cytochrome P450 2L1 OS=Panulirus argus GN=CYP2L1 PE=1 SV=1 240 485 5.0E-13
sp|Q93Z79|C14A1_ARATH Cytochrome P450 714A1 OS=Arabidopsis thaliana GN=CYP714A1 PE=2 SV=1 322 485 5.0E-13
sp|Q6UEG2|AFLN_ASPPA P450 monooxygenase AflN OS=Aspergillus parasiticus GN=aflN PE=3 SV=1 319 488 5.0E-13
sp|O42430|CP1A1_LIMLI Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 PE=2 SV=1 252 489 5.0E-13
sp|O81117|C94A1_VICSA Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 274 490 5.0E-13
sp|O65438|C71AR_ARATH Cytochrome P450 71A27 OS=Arabidopsis thaliana GN=CYP71A27 PE=3 SV=3 307 487 6.0E-13
sp|O48922|C98A2_SOYBN Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 181 469 6.0E-13
sp|P48418|C75A1_PETHY Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 291 484 6.0E-13
sp|P79383|CP2E1_PIG Cytochrome P450 2E1 OS=Sus scrofa GN=CYP2E1 PE=2 SV=1 256 495 6.0E-13
sp|Q9V776|CP317_DROME Probable cytochrome P450 317a1 OS=Drosophila melanogaster GN=Cyp317a1 PE=3 SV=2 263 465 6.0E-13
sp|Q4R8S6|CP51A_MACFA Lanosterol 14-alpha demethylase OS=Macaca fascicularis GN=CYP51A1 PE=2 SV=2 246 484 6.0E-13
sp|O42231|CP1A1_LIZAU Cytochrome P450 1A1 OS=Liza aurata GN=cyp1a1 PE=2 SV=1 58 483 6.0E-13
sp|Q12587|CP52Q_CANMA Cytochrome P450 52C2 OS=Candida maltosa GN=CYP52C2 PE=2 SV=1 308 485 7.0E-13
sp|Q9STK7|C71AQ_ARATH Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 320 492 7.0E-13
sp|P10633|CP2D1_RAT Cytochrome P450 2D1 OS=Rattus norvegicus GN=Cyp2d1 PE=2 SV=1 280 505 7.0E-13
sp|Q4PJW3|CP51A_BOVIN Lanosterol 14-alpha demethylase OS=Bos taurus GN=CYP51A1 PE=2 SV=1 246 484 8.0E-13
sp|O18992|CP2DJ_CALJA Cytochrome P450 2D19 OS=Callithrix jacchus GN=CYP2D19 PE=2 SV=1 280 485 8.0E-13
sp|Q92100|CP1A1_PLEPL Cytochrome P450 1A1 OS=Pleuronectes platessa GN=cyp1a1 PE=2 SV=1 252 489 8.0E-13
sp|Q9VYY4|C4G15_DROME Cytochrome P450 4g15 OS=Drosophila melanogaster GN=Cyp4g15 PE=2 SV=1 287 486 8.0E-13
sp|P15149|CP2A2_RAT Cytochrome P450 2A2 OS=Rattus norvegicus GN=Cyp2a2 PE=1 SV=1 252 487 8.0E-13
sp|Q92090|CP2K1_ONCMY Cytochrome P450 2K1 OS=Oncorhynchus mykiss GN=cyp2k1 PE=2 SV=1 223 488 8.0E-13
sp|Q9LTM6|C71BH_ARATH Cytochrome P450 71B17 OS=Arabidopsis thaliana GN=CYP71B17 PE=3 SV=1 287 465 8.0E-13
sp|Q8TAV3|CP2W1_HUMAN Cytochrome P450 2W1 OS=Homo sapiens GN=CYP2W1 PE=1 SV=2 286 488 9.0E-13
sp|O04164|C71A6_NEPRA Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 291 469 9.0E-13
sp|Q5RE72|CP51A_PONAB Lanosterol 14-alpha demethylase OS=Pongo abelii GN=CYP51A1 PE=2 SV=2 246 484 9.0E-13
sp|P30437|CP17A_ONCMY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1 322 514 9.0E-13
sp|Q29473|CP2DF_CANLF Cytochrome P450 2D15 OS=Canis lupus familiaris GN=CYP2D15 PE=1 SV=3 251 485 1.0E-12
sp|O65790|C81F1_ARATH Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 291 479 1.0E-12
sp|P12791|CP2BA_MOUSE Cytochrome P450 2B10 OS=Mus musculus GN=Cyp2b10 PE=1 SV=1 254 486 1.0E-12
sp|P30607|CP52B_CANTR Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 199 485 1.0E-12
sp|O65788|C71B2_ARATH Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 283 475 1.0E-12
sp|Q9LTM0|C71BN_ARATH Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 156 475 1.0E-12
sp|Q92088|CP2M1_ONCMY Cytochrome P450 2M1 OS=Oncorhynchus mykiss GN=cyp2m1 PE=1 SV=1 271 485 1.0E-12
sp|P79760|CP1A4_CHICK Cytochrome P450 1A4 OS=Gallus gallus GN=CYP1A4 PE=2 SV=1 264 476 1.0E-12
sp|Q1ZXL2|C518B_DICDI Probable cytochrome P450 518B1 OS=Dictyostelium discoideum GN=cyp518B1 PE=3 SV=1 286 514 1.0E-12
sp|Q9STK8|C71AP_ARATH Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 291 463 1.0E-12
sp|Q50LH4|C7193_ESCCA (S)-stylopine synthase 2 OS=Eschscholzia californica GN=CYP719A3 PE=1 SV=1 254 478 1.0E-12
sp|P33265|CP2CS_MESAU Cytochrome P450 2C28 OS=Mesocricetus auratus GN=CYP2C28 PE=2 SV=1 292 495 1.0E-12
sp|P30608|CP52F_CANTR Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 308 476 1.0E-12
sp|D5J9U8|GAO_LACSA Germacrene A oxidase OS=Lactuca sativa GN=GAO1 PE=1 SV=1 291 475 1.0E-12
sp|Q54ZM4|C518A_DICDI Probable cytochrome P450 518A1 OS=Dictyostelium discoideum GN=cyp518A1 PE=3 SV=1 286 515 1.0E-12
sp|Q12581|CP52X_CANMA Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 275 489 1.0E-12
sp|Q9V6H1|CP9H1_DROME Probable cytochrome P450 9h1 OS=Drosophila melanogaster GN=Cyp9h1 PE=3 SV=1 271 492 1.0E-12
sp|Q9VGB4|CP132_DROME Probable cytochrome P450 313a2 OS=Drosophila melanogaster GN=Cyp313a2 PE=3 SV=3 124 487 2.0E-12
sp|Q92087|CP19A_ORYLA Aromatase OS=Oryzias latipes GN=cyp19a1 PE=2 SV=1 311 488 2.0E-12
sp|P56592|CP1A2_CANLF Cytochrome P450 1A2 OS=Canis lupus familiaris GN=CYP1A2 PE=1 SV=2 173 516 2.0E-12
sp|I3PFJ5|C76AD_BETVU Cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=2 SV=1 218 469 2.0E-12
sp|Q92104|CP11B_LITCT Cytochrome P450 11B, mitochondrial OS=Lithobates catesbeiana GN=CYP11B PE=2 SV=1 306 504 2.0E-12
sp|P43083|CP52V_CANAP Cytochrome P450 52E1 OS=Candida apicola GN=CYP52E1 PE=3 SV=1 50 512 2.0E-12
sp|Q05421|CP2E1_MOUSE Cytochrome P450 2E1 OS=Mus musculus GN=Cyp2e1 PE=1 SV=1 291 495 2.0E-12
sp|Q9C5Y2|KAO2_ARATH Ent-kaurenoic acid oxidase 2 OS=Arabidopsis thaliana GN=KAO2 PE=2 SV=2 252 486 2.0E-12
sp|O80823|C86A8_ARATH Cytochrome P450 86A8 OS=Arabidopsis thaliana GN=CYP86A8 PE=2 SV=1 243 479 2.0E-12
sp|Q27698|CP6D1_MUSDO Cytochrome P450 6d1 OS=Musca domestica GN=CYP6D1 PE=1 SV=1 291 514 2.0E-12
sp|O22203|C98A3_ARATH Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 171 478 2.0E-12
sp|P58048|C71B8_ARATH Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 312 469 2.0E-12
sp|Q8LIF2|C7345_ORYSJ Cytochrome P450 734A5 OS=Oryza sativa subsp. japonica GN=CYP734A5 PE=2 SV=1 307 487 2.0E-12
sp|Q6WNR0|C81E7_MEDTR Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 318 469 2.0E-12
sp|P33260|CP2CI_HUMAN Cytochrome P450 2C18 OS=Homo sapiens GN=CYP2C18 PE=1 SV=3 245 495 3.0E-12
sp|P16141|CP52D_CANMA Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 251 512 3.0E-12
sp|O81972|C82A2_SOYBN Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 292 493 3.0E-12
sp|P24461|CP2G1_RABIT Cytochrome P450 2G1 OS=Oryctolagus cuniculus GN=CYP2G1 PE=1 SV=1 265 489 3.0E-12
sp|O64638|C76C3_ARATH Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 267 479 3.0E-12
sp|P98188|C94A2_VICSA Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE=2 SV=1 112 508 3.0E-12
sp|Q9LJY7|C75AK_ARATH Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 320 469 3.0E-12
sp|Q4V8D1|CP2U1_RAT Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 298 520 3.0E-12
sp|E1B2Z9|C7AV8_CICIN Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 280 475 3.0E-12
sp|Q92116|CP1A1_STECH Cytochrome P450 1A1 OS=Stenotomus chrysops GN=cyp1a1 PE=2 SV=1 252 514 3.0E-12
sp|Q9LTM7|C71BG_ARATH Cytochrome P450 71B16 OS=Arabidopsis thaliana GN=CYP71B16 PE=3 SV=1 123 475 3.0E-12
sp|P56654|CP237_MOUSE Cytochrome P450 2C37 OS=Mus musculus GN=Cyp2c37 PE=1 SV=2 296 495 3.0E-12
sp|Q6YTF1|C76M8_ORYSJ Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 320 479 3.0E-12
sp|Q50LH3|C7192_ESCCA (S)-stylopine synthase 1 OS=Eschscholzia californica GN=CYP719A2 PE=1 SV=1 318 487 3.0E-12
sp|P20853|CP2A7_HUMAN Cytochrome P450 2A7 OS=Homo sapiens GN=CYP2A7 PE=2 SV=2 252 487 3.0E-12
sp|O81973|C93A3_SOYBN Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 270 469 4.0E-12
sp|Q05556|CP2AB_RABIT Cytochrome P450 2A11 OS=Oryctolagus cuniculus GN=CYP2A11 PE=1 SV=1 252 487 4.0E-12
sp|F8S1I0|C7BL2_LACSA Costunolide synthase OS=Lactuca sativa GN=CYP71BL2 PE=1 SV=1 289 465 4.0E-12
sp|P11371|CP2C4_RABIT Cytochrome P450 2C4 OS=Oryctolagus cuniculus GN=CYP2C4 PE=2 SV=1 227 504 4.0E-12
sp|Q55AJ4|C516B_DICDI Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 287 515 4.0E-12
sp|Q91W64|CP270_MOUSE Cytochrome P450 2C70 OS=Mus musculus GN=Cyp2c70 PE=1 SV=2 219 504 4.0E-12
sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 320 469 4.0E-12
sp|P58045|C71AE_ARATH Cytochrome P450 71A14 OS=Arabidopsis thaliana GN=CYP71A14 PE=2 SV=1 259 487 4.0E-12
sp|P11509|CP2A6_HUMAN Cytochrome P450 2A6 OS=Homo sapiens GN=CYP2A6 PE=1 SV=3 265 487 4.0E-12
sp|B3RFJ6|86A22_PETHY Cytochrome P450 86A22 OS=Petunia hybrida GN=CYP86A22 PE=1 SV=1 288 494 4.0E-12
sp|O73853|CP17A_ICTPU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 322 493 4.0E-12
sp|P20852|CP2A5_MOUSE Cytochrome P450 2A5 OS=Mus musculus GN=Cyp2a5 PE=2 SV=1 252 487 5.0E-12
sp|Q92148|CP1A1_MICTO Cytochrome P450 1A1 OS=Microgadus tomcod GN=cyp1a1 PE=2 SV=1 251 483 5.0E-12
sp|P00179|CP2C5_RABIT Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2 224 504 5.0E-12
sp|Q9N0U7|CP17A_CAPHI Steroid 17-alpha-hydroxylase/17,20 lyase OS=Capra hircus GN=CYP17A1 PE=2 SV=1 301 487 5.0E-12
sp|Q9VGZ0|C12E1_DROME Probable cytochrome P450 12e1, mitochondrial OS=Drosophila melanogaster GN=Cyp12e1 PE=2 SV=4 316 504 5.0E-12
sp|D5JBX1|GAO_BARSP Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 287 475 5.0E-12
sp|Q9XHC6|C93E1_SOYBN Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 291 469 5.0E-12
sp|Q96SQ9|CP2S1_HUMAN Cytochrome P450 2S1 OS=Homo sapiens GN=CYP2S1 PE=1 SV=2 226 476 5.0E-12
sp|P56657|CP240_MOUSE Cytochrome P450 2C40 OS=Mus musculus GN=Cyp2c40 PE=1 SV=2 296 511 6.0E-12
sp|P24458|CP52E_CANMA Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 308 484 6.0E-12
sp|P15392|CP2A4_MOUSE Cytochrome P450 2A4 OS=Mus musculus GN=Cyp2a4 PE=2 SV=3 252 495 6.0E-12
sp|P00178|CP2B4_RABIT Cytochrome P450 2B4 OS=Oryctolagus cuniculus GN=CYP2B4 PE=1 SV=1 267 486 6.0E-12
sp|Q5UQ90|YL532_MIMIV Cytochrome P450-like protein L532 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L532 PE=1 SV=1 255 515 6.0E-12
sp|D5JBW9|GAO_SAUCO Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 280 475 6.0E-12
sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 312 491 6.0E-12
sp|P21595|CP56_YEAST Cytochrome P450-DIT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIT2 PE=1 SV=2 241 484 7.0E-12
sp|P12939|CP2DA_RAT Cytochrome P450 2D10 OS=Rattus norvegicus GN=Cyp2d10 PE=1 SV=1 251 485 7.0E-12
sp|P24455|CP2A9_MESAU Cytochrome P450 2A9 OS=Mesocricetus auratus GN=CYP2A9 PE=2 SV=2 165 487 7.0E-12
sp|P79761|CP1A5_CHICK Cytochrome P450 1A5 OS=Gallus gallus GN=CYP1A5 PE=2 SV=1 252 483 7.0E-12
sp|Q7Z449|CP2U1_HUMAN Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 298 514 7.0E-12
sp|Q9GMC7|CP17A_BISBI Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bison bison GN=CYP17A1 PE=2 SV=1 301 486 8.0E-12
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 124 495 8.0E-12
sp|Q05555|CP2AA_RABIT Cytochrome P450 2A10 OS=Oryctolagus cuniculus GN=CYP2A10 PE=1 SV=1 252 487 9.0E-12
sp|Q6NKZ8|C14A2_ARATH Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1 289 485 9.0E-12
sp|Q08078|CP2CP_MESAU Cytochrome P450 2C25 OS=Mesocricetus auratus GN=CYP2C25 PE=2 SV=1 286 504 9.0E-12
sp|P05185|CP17A_BOVIN Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bos taurus GN=CYP17A1 PE=2 SV=1 301 486 1.0E-11
sp|Q9W683|CP1A1_LIZSA Cytochrome P450 1A1 OS=Liza saliens GN=cyp1a1 PE=2 SV=1 65 483 1.0E-11
sp|A1DA63|FTME_NEOFI Fumitremorgin C synthase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-2 PE=3 SV=1 298 501 1.0E-11
sp|Q9STL1|C71AM_ARATH Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 288 487 1.0E-11
sp|P33261|CP2CJ_HUMAN Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3 292 495 1.0E-11
sp|P08686|CP21A_HUMAN Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 125 488 1.0E-11
sp|P70085|CP17A_ORYLA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 289 521 1.0E-11
sp|Q16696|CP2AD_HUMAN Cytochrome P450 2A13 OS=Homo sapiens GN=CYP2A13 PE=1 SV=3 252 487 1.0E-11
sp|Q9V558|CP4P1_DROME Cytochrome P450 4p1 OS=Drosophila melanogaster GN=Cyp4p1 PE=2 SV=1 79 514 1.0E-11
sp|P17177|CP27A_RABIT Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 307 495 1.0E-11
sp|Q29497|CP17A_SHEEP Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ovis aries GN=CYP17A1 PE=2 SV=2 301 487 1.0E-11
sp|P20812|CP2A3_RAT Cytochrome P450 2A3 OS=Rattus norvegicus GN=Cyp2a3 PE=2 SV=1 252 487 1.0E-11
sp|Q6VVW9|CP2R1_MOUSE Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1 PE=2 SV=1 320 487 1.0E-11
sp|Q9V557|CP4P2_DROME Probable cytochrome P450 4p2 OS=Drosophila melanogaster GN=Cyp4p2 PE=2 SV=1 76 515 2.0E-11
sp|Q9GQM9|CP6L1_BLAGE Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 311 476 2.0E-11
sp|Q6QNI4|C71AJ_AMMMJ Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 288 484 2.0E-11
sp|G3GBK0|C7BL3_CICIN Costunolide synthase OS=Cichorium intybus GN=CYP71BL3 PE=1 SV=1 289 465 2.0E-11
sp|Q92045|CP11A_DASAM Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 123 494 2.0E-11
sp|Q9V6D6|CP301_DROME Probable cytochrome P450 301a1, mitochondrial OS=Drosophila melanogaster GN=Cyp301a1 PE=2 SV=1 64 486 2.0E-11
sp|Q9T0K0|C71AJ_ARATH Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 320 495 2.0E-11
sp|Q9V979|CP6U1_DROME Probable cytochrome P450 6u1 OS=Drosophila melanogaster GN=Cyp6u1 PE=2 SV=3 277 492 2.0E-11
sp|Q91Z85|CP17A_PERLE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Peromyscus leucopus GN=Cyp17a1 PE=3 SV=1 319 513 2.0E-11
sp|Q9LW27|C71BF_ARATH Bifunctional dihydrocamalexate synthase/camalexin synthase OS=Arabidopsis thaliana GN=CYP71B15 PE=1 SV=1 291 501 2.0E-11
sp|Q9V3S0|CP4G1_DROME Cytochrome P450 4g1 OS=Drosophila melanogaster GN=Cyp4g1 PE=2 SV=1 287 518 2.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No
GO:0046906 tetrapyrrole binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 1018 1040 22
3 1042 1064 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3826
MILQHVFTWWAVPVLVVVWYGYGYLFSHRHLRGIPAPLGAQLSDLWLAMVARMRGRSLYVDRAHQRLGKMVRIQP
NHVSIADESAIAAVYGHGNGFLKTEFYDVFVSVLPSVFNTRSRSAHARKRKFVSNAFSLRTVTEFEPYIYSALEI
FIAKLDTLINESPHRNEKGKPEARVDAFSWLNFLAFDIIGDLAFGAPFGMLQRGADEVEVRDGFEGPSKFVSAVE
LLHSRGETNATLGCIPWFKPWVTSNILPIPSLRKGIAANERFTGVAAARVKQRLNPSEPPLEKRRDILARLIESR
DEDGKPLDVKELTAEATAYLVAGSDTTSTALCITMESLSRHPHALKRLQTELDAVMPSDVIIPHASDVNDLPYLN
WVVNESLRYHTILGLGLPRRIPDDSAGVTILGRYFPPGTVLSVPTYTLHHDREIWGDDADEFKPERWATLTTRQK
TAFNPFSYGPRACIGRNLAEMEVRLITAAWARRYAVRPLAETESVVKEGFLRKPVRVDMALSRRKFHTSIFVHSV
IAITGLACETSVFTKARTQAADFRPQRGDDVISVYRFLHGDQPLGREARWKGALIGHALPGGMVTREAFEALAGE
IVHRLEAIVAEEREGIDGLWFDIHGAMCVEGLDDAEAELLRRIRPVVGQRVIVSASMDLHGNVSAELAHICDLIT
CYRKAPHEDELETKERACRNLVKLLVATPGSVQRPLKAWIPVPVLLPGEQTSTRVDPARRVYAAVAEVAAREGVI
DAALWVGYPWSDEPRNRAVVMVVGWEKGPVGEGAERLARLFWDARSEFKFVAAADSLNVCLDAAIASPREKRPFF
VSDSGDNPTAGGSGDVTWSLTRILDRPEFKTDPGRYTVIYASLPGPSAVETAAAAGVGATVSVVAGADVDDQFGP
PLKMTGEVYAVKRGDKYAEMEVVVRVGCVFVILTKRRKPYHKERDFTDLKLRPREADIVIVKIGYLEPELYDMAK
GWVLALTPGGVDQDLPRLGHKRIWRPMWPFDRLFLFLFSSPRAIITTVVVVLVIVVVIIVLVIVIVIVVVVVVVV
VLVLVVIIVITTTTRM*
Coding >Ophun1|3826
ATGATTCTTCAGCACGTCTTCACCTGGTGGGCTGTCCCCGTCCTCGTAGTCGTCTGGTATGGCTACGGCTACCTC
TTCTCTCATCGTCATCTGCGCGGCATCCCCGCCCCGCTGGGAGCACAGCTCTCTGATCTGTGGCTGGCCATGGTT
GCGCGGATGCGTGGTCGGTCGCTGTATGTGGACAGGGCTCATCAGCGGTTGGGGAAGATGGTGAGGATACAGCCC
AATCACGTCAGTATCGCAGACGAGAGCGCCATTGCCGCCGTCTATGGCCATGGGAATGGCTTTCTCAAGACGGAA
TTCTACGACGTCTTTGTCTCTGTCCTCCCAAGCGTCTTCAACACCCGCTCCCGTTCCGCCCACGCCCGGAAGCGC
AAATTCGTCTCAAACGCCTTCTCCCTCCGCACCGTCACCGAGTTCGAGCCCTACATCTACTCCGCGCTGGAGATC
TTCATCGCCAAGCTCGACACCCTCATCAACGAGAGCCCGCACCGCAATGAGAAGGGCAAGCCGGAGGCCCGTGTC
GACGCCTTCTCCTGGCTCAACTTCCTCGCCTTTGATATCATCGGGGATCTCGCCTTTGGGGCTCCGTTTGGTATG
CTTCAGAGGGGGGCTGATGAGGTAGAGGTCAGGGACGGCTTCGAAGGGCCTTCGAAATTCGTCTCTGCTGTCGAG
TTGCTTCACTCAAGAGGAGAGACGAACGCTACGCTTGGCTGCATACCGTGGTTCAAGCCATGGGTGACATCCAAT
ATCCTGCCCATCCCCTCCCTACGGAAAGGCATCGCCGCAAATGAGCGCTTCACAGGCGTAGCCGCCGCCCGCGTA
AAGCAACGACTCAACCCATCCGAACCCCCCCTCGAGAAACGAAGAGATATCCTGGCCCGCCTCATCGAAAGCCGC
GACGAAGACGGTAAGCCCCTGGATGTCAAGGAACTCACCGCCGAAGCAACAGCCTACCTCGTCGCCGGCAGCGAC
ACCACTTCCACTGCGCTCTGCATCACCATGGAGAGTCTCTCCCGCCATCCCCACGCCTTGAAGCGACTGCAGACG
GAACTCGACGCCGTGATGCCATCCGACGTCATCATCCCGCATGCCAGCGACGTCAACGACCTCCCGTACCTGAAC
TGGGTAGTCAATGAGAGTCTCCGCTACCACACCATCCTCGGCCTCGGCCTCCCGCGCCGCATCCCGGACGACTCG
GCCGGCGTCACCATCCTGGGCCGGTACTTTCCGCCGGGCACCGTCCTCAGCGTCCCGACTTACACCCTTCACCAC
GACCGCGAAATTTGGGGCGACGACGCCGACGAGTTTAAGCCCGAGCGGTGGGCGACGCTGACGACAAGGCAGAAG
ACGGCCTTTAACCCGTTCAGCTATGGGCCGCGTGCCTGCATTGGCCGTAATCTGGCTGAGATGGAGGTGAGACTC
ATCACGGCTGCGTGGGCGAGGAGGTATGCTGTGAGGCCCCTGGCCGAGACGGAGAGTGTCGTCAAGGAGGGTTTC
TTGAGAAAGCCGGTGAGGGTCGACATGGCATTGAGCCGGAGGAAATTTCATACCAGTATATTCGTACATTCAGTA
ATCGCCATCACCGGTCTGGCCTGCGAGACATCCGTCTTCACCAAGGCACGCACCCAAGCAGCCGATTTCCGACCC
CAGCGCGGAGACGACGTCATCAGCGTCTACCGCTTCCTCCATGGCGACCAGCCGCTGGGGCGGGAAGCGCGGTGG
AAGGGCGCCTTGATCGGACACGCGCTGCCTGGCGGTATGGTGACTCGCGAGGCGTTTGAGGCGCTGGCGGGGGAG
ATTGTCCATCGTCTGGAGGCTATCGTGGCTGAAGAGCGGGAGGGTATCGATGGGCTGTGGTTCGATATCCACGGT
GCCATGTGCGTGGAAGGACTGGACGATGCCGAGGCAGAGCTCTTGCGAAGAATTCGTCCCGTGGTTGGGCAGCGA
GTCATCGTCTCGGCTTCGATGGATCTTCATGGCAACGTCTCGGCTGAACTCGCCCACATATGCGACCTCATCACC
TGCTATCGCAAGGCACCCCACGAAGACGAGCTAGAGACGAAAGAACGGGCGTGTCGCAACCTGGTGAAGCTGCTC
GTCGCGACTCCGGGTTCTGTCCAACGACCGCTGAAGGCATGGATCCCCGTGCCCGTGCTGCTGCCAGGGGAGCAG
ACTTCAACCCGCGTCGATCCCGCTCGTCGGGTGTACGCTGCTGTGGCCGAGGTAGCAGCCCGCGAGGGCGTCATC
GATGCTGCCCTCTGGGTTGGCTACCCATGGTCCGACGAGCCGAGGAACAGGGCTGTCGTCATGGTAGTCGGTTGG
GAGAAGGGACCTGTGGGTGAAGGGGCGGAACGACTGGCCCGACTCTTCTGGGACGCGCGGTCCGAGTTTAAGTTC
GTGGCTGCAGCCGACTCGCTAAACGTCTGTCTAGACGCTGCCATCGCCTCCCCACGCGAGAAGCGGCCATTCTTC
GTGTCAGACTCGGGCGATAACCCGACTGCTGGTGGCTCCGGCGACGTCACCTGGAGTCTGACCAGGATCCTGGAT
CGACCCGAGTTCAAGACGGATCCGGGGCGGTACACGGTCATCTACGCCAGTCTCCCCGGCCCTTCGGCGGTCGAG
ACGGCGGCGGCGGCGGGCGTGGGCGCTACCGTGAGTGTCGTTGCTGGGGCCGACGTCGATGATCAGTTTGGACCG
CCGCTGAAGATGACGGGGGAGGTGTACGCTGTGAAGAGGGGGGATAAGTATGCCGAGATGGAGGTCGTTGTTCGC
GTTGGATGCGTCTTTGTCATTCTAACGAAGCGGCGGAAGCCGTATCACAAGGAGAGGGACTTTACGGACCTCAAG
CTACGGCCCAGGGAAGCTGATATCGTCATCGTCAAGATTGGATACCTCGAGCCGGAGCTGTATGACATGGCCAAG
GGGTGGGTGCTAGCTCTTACACCAGGCGGTGTAGATCAGGATCTGCCGAGGCTGGGGCATAAGCGGATCTGGAGG
CCCATGTGGCCGTTTGACAGGCTTTTCCTTTTTCTTTTCTCTTCTCCTCGTGCCATCATCACCACCGTCGTCGTC
GTCCTCGTCATCGTCGTCGTCATCATCGTCCTCGTCATCGTCATCGTCATCGTCGTCGTCGTCGTCGTCGTCGTC
GTCCTCGTCCTCGTCGTCATCATCGTCATCACCACCACCACCAGAATGTAA
Transcript >Ophun1|3826
ATGATTCTTCAGCACGTCTTCACCTGGTGGGCTGTCCCCGTCCTCGTAGTCGTCTGGTATGGCTACGGCTACCTC
TTCTCTCATCGTCATCTGCGCGGCATCCCCGCCCCGCTGGGAGCACAGCTCTCTGATCTGTGGCTGGCCATGGTT
GCGCGGATGCGTGGTCGGTCGCTGTATGTGGACAGGGCTCATCAGCGGTTGGGGAAGATGGTGAGGATACAGCCC
AATCACGTCAGTATCGCAGACGAGAGCGCCATTGCCGCCGTCTATGGCCATGGGAATGGCTTTCTCAAGACGGAA
TTCTACGACGTCTTTGTCTCTGTCCTCCCAAGCGTCTTCAACACCCGCTCCCGTTCCGCCCACGCCCGGAAGCGC
AAATTCGTCTCAAACGCCTTCTCCCTCCGCACCGTCACCGAGTTCGAGCCCTACATCTACTCCGCGCTGGAGATC
TTCATCGCCAAGCTCGACACCCTCATCAACGAGAGCCCGCACCGCAATGAGAAGGGCAAGCCGGAGGCCCGTGTC
GACGCCTTCTCCTGGCTCAACTTCCTCGCCTTTGATATCATCGGGGATCTCGCCTTTGGGGCTCCGTTTGGTATG
CTTCAGAGGGGGGCTGATGAGGTAGAGGTCAGGGACGGCTTCGAAGGGCCTTCGAAATTCGTCTCTGCTGTCGAG
TTGCTTCACTCAAGAGGAGAGACGAACGCTACGCTTGGCTGCATACCGTGGTTCAAGCCATGGGTGACATCCAAT
ATCCTGCCCATCCCCTCCCTACGGAAAGGCATCGCCGCAAATGAGCGCTTCACAGGCGTAGCCGCCGCCCGCGTA
AAGCAACGACTCAACCCATCCGAACCCCCCCTCGAGAAACGAAGAGATATCCTGGCCCGCCTCATCGAAAGCCGC
GACGAAGACGGTAAGCCCCTGGATGTCAAGGAACTCACCGCCGAAGCAACAGCCTACCTCGTCGCCGGCAGCGAC
ACCACTTCCACTGCGCTCTGCATCACCATGGAGAGTCTCTCCCGCCATCCCCACGCCTTGAAGCGACTGCAGACG
GAACTCGACGCCGTGATGCCATCCGACGTCATCATCCCGCATGCCAGCGACGTCAACGACCTCCCGTACCTGAAC
TGGGTAGTCAATGAGAGTCTCCGCTACCACACCATCCTCGGCCTCGGCCTCCCGCGCCGCATCCCGGACGACTCG
GCCGGCGTCACCATCCTGGGCCGGTACTTTCCGCCGGGCACCGTCCTCAGCGTCCCGACTTACACCCTTCACCAC
GACCGCGAAATTTGGGGCGACGACGCCGACGAGTTTAAGCCCGAGCGGTGGGCGACGCTGACGACAAGGCAGAAG
ACGGCCTTTAACCCGTTCAGCTATGGGCCGCGTGCCTGCATTGGCCGTAATCTGGCTGAGATGGAGGTGAGACTC
ATCACGGCTGCGTGGGCGAGGAGGTATGCTGTGAGGCCCCTGGCCGAGACGGAGAGTGTCGTCAAGGAGGGTTTC
TTGAGAAAGCCGGTGAGGGTCGACATGGCATTGAGCCGGAGGAAATTTCATACCAGTATATTCGTACATTCAGTA
ATCGCCATCACCGGTCTGGCCTGCGAGACATCCGTCTTCACCAAGGCACGCACCCAAGCAGCCGATTTCCGACCC
CAGCGCGGAGACGACGTCATCAGCGTCTACCGCTTCCTCCATGGCGACCAGCCGCTGGGGCGGGAAGCGCGGTGG
AAGGGCGCCTTGATCGGACACGCGCTGCCTGGCGGTATGGTGACTCGCGAGGCGTTTGAGGCGCTGGCGGGGGAG
ATTGTCCATCGTCTGGAGGCTATCGTGGCTGAAGAGCGGGAGGGTATCGATGGGCTGTGGTTCGATATCCACGGT
GCCATGTGCGTGGAAGGACTGGACGATGCCGAGGCAGAGCTCTTGCGAAGAATTCGTCCCGTGGTTGGGCAGCGA
GTCATCGTCTCGGCTTCGATGGATCTTCATGGCAACGTCTCGGCTGAACTCGCCCACATATGCGACCTCATCACC
TGCTATCGCAAGGCACCCCACGAAGACGAGCTAGAGACGAAAGAACGGGCGTGTCGCAACCTGGTGAAGCTGCTC
GTCGCGACTCCGGGTTCTGTCCAACGACCGCTGAAGGCATGGATCCCCGTGCCCGTGCTGCTGCCAGGGGAGCAG
ACTTCAACCCGCGTCGATCCCGCTCGTCGGGTGTACGCTGCTGTGGCCGAGGTAGCAGCCCGCGAGGGCGTCATC
GATGCTGCCCTCTGGGTTGGCTACCCATGGTCCGACGAGCCGAGGAACAGGGCTGTCGTCATGGTAGTCGGTTGG
GAGAAGGGACCTGTGGGTGAAGGGGCGGAACGACTGGCCCGACTCTTCTGGGACGCGCGGTCCGAGTTTAAGTTC
GTGGCTGCAGCCGACTCGCTAAACGTCTGTCTAGACGCTGCCATCGCCTCCCCACGCGAGAAGCGGCCATTCTTC
GTGTCAGACTCGGGCGATAACCCGACTGCTGGTGGCTCCGGCGACGTCACCTGGAGTCTGACCAGGATCCTGGAT
CGACCCGAGTTCAAGACGGATCCGGGGCGGTACACGGTCATCTACGCCAGTCTCCCCGGCCCTTCGGCGGTCGAG
ACGGCGGCGGCGGCGGGCGTGGGCGCTACCGTGAGTGTCGTTGCTGGGGCCGACGTCGATGATCAGTTTGGACCG
CCGCTGAAGATGACGGGGGAGGTGTACGCTGTGAAGAGGGGGGATAAGTATGCCGAGATGGAGGTCGTTGTTCGC
GTTGGATGCGTCTTTGTCATTCTAACGAAGCGGCGGAAGCCGTATCACAAGGAGAGGGACTTTACGGACCTCAAG
CTACGGCCCAGGGAAGCTGATATCGTCATCGTCAAGATTGGATACCTCGAGCCGGAGCTGTATGACATGGCCAAG
GGGTGGGTGCTAGCTCTTACACCAGGCGGTGTAGATCAGGATCTGCCGAGGCTGGGGCATAAGCGGATCTGGAGG
CCCATGTGGCCGTTTGACAGGCTTTTCCTTTTTCTTTTCTCTTCTCCTCGTGCCATCATCACCACCGTCGTCGTC
GTCCTCGTCATCGTCGTCGTCATCATCGTCCTCGTCATCGTCATCGTCATCGTCGTCGTCGTCGTCGTCGTCGTC
GTCCTCGTCCTCGTCGTCATCATCGTCATCACCACCACCACCAGAATGTAA
Gene >Ophun1|3826
ATGATTCTTCAGCACGTCTTCACCTGGTGGGCTGTCCCCGTCCTCGTAGTCGTCTGGTATGGCTACGGCTACCTC
TTCTCTCATCGTCATCTGCGCGGCATCCCCGCCCCGCTGGGAGCACAGCTCTCTGATCTGTGGCTGGCCATGGTT
GCGCGGATGCGTGGTCGGTCGCTGTATGTGGACAGGGCTCATCAGCGGTTGGGGAAGATGGTGAGGATACAGCCC
AATCACGTCAGTATCGCAGACGAGAGCGCCATTGCCGCCGTCTATGGCCATGGGAATGGCTTTCTCAAGACGTAC
GTTCTCTATCCGATCCTTCTGTAATGTAAGACCTGCTCAGCATACGATGCAGGGAATTCTACGACGTCTTTGTCT
CTGTCCTCCCAAGCGTCTTCAACACCCGCTCCCGTTCCGCCCACGCCCGGAAGCGCAAATTCGTCTCAAACGCCT
TCTCCCTCCGCACCGTCACCGAGTTCGAGCCCTACATCTACTCCGCGCTGGAGATCTTCATCGCCAAGCTCGACA
CCCTCATCAACGAGAGCCCGCACCGCAATGAGAAGGGCAAGCCGGAGGCCCGTGTCGACGCCTTCTCCTGGCTCA
ACTTCCTCGCCTTTGATATCATCGGGGATCTCGCCTTTGGGGCTCCGTTTGGTATGCTTCAGAGGGGGGCTGATG
AGGTAGAGGTCAGGGACGGCTTCGAAGGGCCTTCGAAATTCGTCTCTGCTGTCGAGTTGCTTCACTCAAGAGGAG
AGACGAACGCTACGCTTGGCTGCATACCGTGGTTCAAGCCATGGGTGACATCCAATATCCTGCCCATCCCCTCCC
TACGGAAAGGCATCGCCGCAAATGAGCGCTTCACAGGCGTAGCCGCCGCCCGCGTAAAGCAACGACTCAACCCAT
CCGAACCCCCCCTCGAGAAACGAAGAGATATCCTGGCCCGCCTCATCGAAAGCCGCGACGAAGACGGTAAGCCCC
TGGATGTCAAGGAACTCACCGCCGAAGCAACAGCCTACCTCGTCGCCGGCAGCGACACCACTTCCACTGCGCTCT
GCATCACCATGGAGAGTCTCTCCCGCCATCCCCACGCCTTGAAGCGACTGCAGACGGAACTCGACGCCGTGATGC
CATCCGACGTCATCATCCCGCATGCCAGCGACGTCAACGACCTCCCGTACCTGAACTGGGTAGTCAATGAGAGTC
TCCGCTACCACACCATCCTCGGCCTCGGCCTCCCGCGCCGCATCCCGGACGACTCGGCCGGCGTCACCATCCTGG
GCCGGTACTTTCCGCCGGGCACCGTCCTCAGCGTCCCGACTTACACCCTTCACCACGACCGCGAAATTTGGGGCG
ACGACGCCGACGAGTTTAAGCCCGAGCGGTGGGCGACGCTGACGACAAGGCAGAAGACGGCCTTTAACCCGTTCA
GCTATGGGCCGCGTGCCTGCATTGGCCGTAATCTGGCTGAGATGGAGGTGAGACTCATCACGGCTGCGTGGGCGA
GGAGGTATGCTGTGAGGCCCCTGGCCGAGACGGAGAGTGTCGTCAAGGAGGGTTTCTTGAGAAAGCCGGTGAGGG
TCGACATGGCATTGAGCCGGAGGTTTGAGAGTGCAGATTAGTAGGAGTGCGTTCTGGAAATAGACTGTATGCCCT
GTTCTTCCCCATCCCCATCCCCTGTTGGAAGTGTCGATCTTGCTTGAATTGGCCCCGGAGACCTTGTCATTTAGC
TCAGGAAATTTCATACCAGTATATTCGTACATTCAGGTCTGTGCATGCAAAATACTGTCGATGTGAGGCTGATGT
AAGATTAGACCTGGGGTCATGTGTCCGTACGAATATCTTAGGTATGAGGTATATCTCCAAAGGGTAGCATCGAGC
GCCGACTTTAGGCACTGCAGTCGTCGTGAGGAGAAGCAGGCCGACATGTTCGCCCTTCACCAGCCACCATGTCCC
GACGCCCAGTAATCGCCATCACCGGTCTGGCCTGCGAGACATCCGTCTTCACCAAGGCACGCACCCAAGCAGCCG
ATTTCCGACCCCAGCGCGGAGACGACGTCATCAGCGTCTACCGCTTCCTCCATGGCGACCAGCCGCTGGGGCGGG
AAGCGCGGTGGAAGGGCGCCTTGATCGGACACGCGCTGCCTGGCGGTATGGTGACTCGCGAGGCGTTTGAGGCGC
TGGCGGGGGAGATTGTCCATCGTCTGGAGGCTATCGTGGCTGAAGAGCGGGAGGGTATCGATGGGCTGTGGTTCG
ATATCCACGGTGCCATGTGCGTGGAAGGACTGGACGATGCCGAGGCAGAGCTCTTGCGAAGAATTCGTCCCGTGG
TTGGGCAGCGAGTCATCGTCTCGGCTTCGATGGATCTTCATGGCAACGTCTCGGCTGAACTCGCCCACATATGCG
ACCTCATCACCTGCTATCGCAAGGCACCCCACGAAGACGAGCTAGAGACGAAAGAACGGGCGTGTCGCAACCTGG
TGAAGCTGCTCGTCGCGACTCCGGGTTCTGTCCAACGACCGCTGAAGGCATGGATCCCCGTGCCCGTGCTGCTGC
CAGGGGAGCAGACTTCAACCCGCGTCGATCCCGCTCGTCGGGTGTACGCTGCTGTGGCCGAGGTAGCAGCCCGCG
AGGGCGTCATCGATGCTGCCCTCTGGGTTGGCTACCCATGGTCCGACGAGCCGAGGAACAGGGCTGTCGTCATGG
TAGTCGGTTGGGAGAAGGGACCTGTGGGTGAAGGGGCGGAACGACTGGCCCGACTCTTCTGGGACGCGCGGTCCG
AGTTTAAGTTCGTGGCTGCAGCCGACTCGCTAAACGTCTGTCTAGACGCTGCCATCGCCTCCCCACGCGAGAAGC
GGCCATTCTTCGTGTCAGACTCGGGCGATAACCCGACTGCTGGTGGCTCCGGCGACGTCACCTGGAGTCTGACCA
GGATCCTGGATCGACCCGAGTTCAAGACGGATCCGGGGCGGTACACGGTCATCTACGCCAGTCTCCCCGGCCCTT
CGGCGGTCGAGACGGCGGCGGCGGCGGGCGTGGGCGCTACCGTGAGTGTCGTTGCTGGGGCCGACGTCGATGATC
AGTTTGGACCGCCGCTGAAGATGACGGGGGAGGTGTACGCTGTGAAGAGGGGGGATAAGTATGCCGAGATGGAGG
TCGTTGTTCGCGTTGGATGCGTCTTTGTCATTCTAACGAAGCGGCGGAAGCCGTATCACAAGGAGAGGGACTTTA
CGGACCTCAAGCTACGGCCCAGGGAAGCTGATATCGTCATCGTCAAGATTGGATACCTCGAGCCGGAGCTGTATG
ACATGGCCAAGGGGTGGGTGCTAGCTCTTACACCAGGCGGTGTAGATCAGGATCTGCCGAGGCTGGGGCATAAGC
GGATCTGGAGGCCCATGTGGCCGTTTGACAGGGTCTTTGAGAGAGAGCCTGATTTACGGACGCGGTGGATTGCGA
GCTAGATGGATGCATTGATGGGTAGTGAGCTTTGTTCAGAGCTCATACGATGACCCCAAACGAGCCGTTGACTAG
GACTTGTTGATCTCTTCCACTGCTTCCCAGCCTGACAGTCTGGAGGGCTAGAGGAAGGCATCTGCCAGATGCTTC
CACAGTCTGCCCAGCTGGTACGTGGGCAGGAGACAGGCAGGTAACCAGAGGAGGTCCAGGTAGCTGCCAGCTGTC
AAGGGAAGGGGTGGAAAGAAACCTGCAGAGCATCCCGTGGATGTGCGATGGACCCACCCTCGCTTACAGCCTCGG
CAGCCAGAAAGGAGAAAGGAAGCTGTCAGTTACGTAGGAAGGTAGCCATGAAGAAGCGTGAGGATAAAGCGCTGG
GCCGTCCTCTAGCTTTTCCTTTTTCTTTTCTCTTCTCCTCGTGCCATCATCACCACCGTCGTCGTCGTCCTCGTC
ATCGTCGTCGTCATCATCGTCCTCGTCATCGTCATCGTCATCGTCGTCGTCGTCGTCGTCGTCGTCGTCCTCGTC
CTCGTCGTCATCATCGTCATCACCACCACCACCAGAATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail