Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3820
Gene name
LocationContig_343:1298..2051
Strand-
Gene length (bp)753
Transcript length (bp)621
Coding sequence length (bp)621
Protein length (aa) 207

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999638

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4518
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4609
Ophiocordyceps australis map64 (Brazil) OphauB2|5460
Ophiocordyceps camponoti-floridani Ophcf2|04650
Ophiocordyceps camponoti-rufipedis Ophun1|3820 (this protein)
Ophiocordyceps kimflemingae Ophio5|5344
Ophiocordyceps subramaniannii Hirsu2|944

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3820
MRASTAVVIFGAAVASAQSQSGGVGNYSSELDMRIDANSIPSQTRAIWCRAQTNTCGLLCDNNTSKNSCVQEELK
YDCVCAGNNSAPALQYYQQTIPTFICETLFSQCDKQNVGNADNQQSCIQNIQNLCGKNAPPKVSSGGSDSGSDGS
DSSSTSASSSSQPTATQAGNNNAVTTTKSGGLAAPTKVPAANGLAFAVAAGVLAIL*
Coding >Ophun1|3820
ATGCGCGCCTCTACTGCTGTCGTCATTTTCGGGGCTGCCGTGGCCTCGGCCCAGAGCCAGTCTGGCGGAGTCGGC
AACTACTCGAGCGAGCTGGACATGCGCATCGATGCCAACTCGATTCCCTCGCAGACACGAGCCATCTGGTGCCGC
GCCCAGACCAACACTTGCGGTCTCCTCTGCGACAACAATACCAGCAAGAACAGCTGCGTCCAGGAGGAGCTCAAG
TACGACTGCGTTTGTGCTGGCAACAACTCGGCCCCGGCCCTGCAGTACTACCAGCAGACGATCCCCACGTTCATC
TGTGAGACGCTCTTCAGCCAGTGCGACAAGCAGAATGTCGGCAACGCGGACAATCAGCAGTCGTGCATCCAGAAC
ATCCAGAACCTCTGCGGCAAGAACGCCCCGCCCAAGGTGTCGAGCGGAGGCAGCGACAGCGGCAGTGATGGCAGC
GACAGCTCCAGCACGTCGGCCTCGAGCTCGTCGCAACCCACGGCCACGCAGGCGGGCAACAACAACGCCGTGACG
ACGACCAAGTCGGGCGGTCTGGCCGCTCCCACCAAGGTGCCGGCCGCCAACGGCTTGGCCTTTGCCGTGGCTGCC
GGTGTCCTGGCCATTCTTTGA
Transcript >Ophun1|3820
ATGCGCGCCTCTACTGCTGTCGTCATTTTCGGGGCTGCCGTGGCCTCGGCCCAGAGCCAGTCTGGCGGAGTCGGC
AACTACTCGAGCGAGCTGGACATGCGCATCGATGCCAACTCGATTCCCTCGCAGACACGAGCCATCTGGTGCCGC
GCCCAGACCAACACTTGCGGTCTCCTCTGCGACAACAATACCAGCAAGAACAGCTGCGTCCAGGAGGAGCTCAAG
TACGACTGCGTTTGTGCTGGCAACAACTCGGCCCCGGCCCTGCAGTACTACCAGCAGACGATCCCCACGTTCATC
TGTGAGACGCTCTTCAGCCAGTGCGACAAGCAGAATGTCGGCAACGCGGACAATCAGCAGTCGTGCATCCAGAAC
ATCCAGAACCTCTGCGGCAAGAACGCCCCGCCCAAGGTGTCGAGCGGAGGCAGCGACAGCGGCAGTGATGGCAGC
GACAGCTCCAGCACGTCGGCCTCGAGCTCGTCGCAACCCACGGCCACGCAGGCGGGCAACAACAACGCCGTGACG
ACGACCAAGTCGGGCGGTCTGGCCGCTCCCACCAAGGTGCCGGCCGCCAACGGCTTGGCCTTTGCCGTGGCTGCC
GGTGTCCTGGCCATTCTTTGA
Gene >Ophun1|3820
ATGCGCGCCTCTACTGCTGTCGTCATTTTCGGGGCTGCCGTGGCCTCGGCCCAGAGCCAGTCTGGCGGAGTCGGC
AACTACTCGAGCGAGCTGGACATGCGCATCGATGCCAACTCGATTCCCTCGCAGACACGAGGTATGCACCCTCGC
CCTCACCCTCACCTTCGTCTCGTGTCTTGGTCATGCGGCTGACAATGCTCTTCACTATAGCCATCTGGTGCCGCG
CCCAGACCAACACTTGCGGTCTCCTCTGCGACAACAATACCAGCAAGAACAGCTGCGTCCAGGTAGGCTCGCTTG
TCCCTCTGTTGCACAAGGTTCACGTCGGCTGACGCTGTTATCCAGGAGGAGCTCAAGTACGACTGCGTTTGTGCT
GGCAACAACTCGGCCCCGGCCCTGCAGTACTACCAGCAGACGATCCCCACGTTCATCTGTGAGACGCTCTTCAGC
CAGTGCGACAAGCAGAATGTCGGCAACGCGGACAATCAGCAGTCGTGCATCCAGAACATCCAGAACCTCTGCGGC
AAGAACGCCCCGCCCAAGGTGTCGAGCGGAGGCAGCGACAGCGGCAGTGATGGCAGCGACAGCTCCAGCACGTCG
GCCTCGAGCTCGTCGCAACCCACGGCCACGCAGGCGGGCAACAACAACGCCGTGACGACGACCAAGTCGGGCGGT
CTGGCCGCTCCCACCAAGGTGCCGGCCGCCAACGGCTTGGCCTTTGCCGTGGCTGCCGGTGTCCTGGCCATTCTT
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail