Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3811
Gene name
LocationContig_342:286..4116
Strand+
Gene length (bp)3830
Transcript length (bp)2649
Coding sequence length (bp)2649
Protein length (aa) 883

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00291 PALP Pyridoxal-phosphate dependent enzyme 2.6E-35 29 292

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P29848|CYSM_SALTY Cysteine synthase B OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysM PE=1 SV=1 29 285 4.0E-15
sp|P71128|CYSM_CAMJE Cysteine synthase B OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=cysM PE=3 SV=2 41 283 4.0E-15
sp|P16703|CYSM_ECOLI Cysteine synthase B OS=Escherichia coli (strain K12) GN=cysM PE=1 SV=1 29 285 1.0E-14
sp|Q9I526|CYSM_PSEAE Cysteine synthase B OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysM PE=3 SV=1 47 289 2.0E-14
sp|Q44004|SBNA_CUPMC Putative siderophore biosynthesis protein SbnA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=sbnA PE=3 SV=2 47 280 8.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P29848|CYSM_SALTY Cysteine synthase B OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysM PE=1 SV=1 29 285 4.0E-15
sp|P71128|CYSM_CAMJE Cysteine synthase B OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=cysM PE=3 SV=2 41 283 4.0E-15
sp|P16703|CYSM_ECOLI Cysteine synthase B OS=Escherichia coli (strain K12) GN=cysM PE=1 SV=1 29 285 1.0E-14
sp|Q9I526|CYSM_PSEAE Cysteine synthase B OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysM PE=3 SV=1 47 289 2.0E-14
sp|Q44004|SBNA_CUPMC Putative siderophore biosynthesis protein SbnA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=sbnA PE=3 SV=2 47 280 8.0E-14
sp|Q59447|CYSK_FLAS3 Cysteine synthase OS=Flavobacterium sp. (strain K3-15 / DSM ID92-509) GN=cysK PE=3 SV=1 29 222 1.0E-12
sp|O45679|CYSK2_CAEEL Bifunctional L-3-cyanoalanine synthase/cysteine synthase OS=Caenorhabditis elegans GN=cysl-2 PE=1 SV=1 41 217 1.0E-12
sp|Q8CMT6|CYSK_STAES Cysteine synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cysK PE=3 SV=1 47 302 3.0E-12
sp|Q5HRP1|CYSK_STAEQ Cysteine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cysK PE=3 SV=1 47 302 3.0E-12
sp|P63872|CYSK_STAAW Cysteine synthase OS=Staphylococcus aureus (strain MW2) GN=cysK PE=3 SV=1 47 302 4.0E-12
sp|Q6GBX5|CYSK_STAAS Cysteine synthase OS=Staphylococcus aureus (strain MSSA476) GN=cysK PE=3 SV=1 47 302 4.0E-12
sp|Q6GJF8|CYSK_STAAR Cysteine synthase OS=Staphylococcus aureus (strain MRSA252) GN=cysK PE=3 SV=1 47 302 4.0E-12
sp|P63871|CYSK_STAAN Cysteine synthase OS=Staphylococcus aureus (strain N315) GN=cysK PE=1 SV=1 47 302 4.0E-12
sp|P63870|CYSK_STAAM Cysteine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cysK PE=3 SV=1 47 302 4.0E-12
sp|Q5HIG2|CYSK_STAAC Cysteine synthase OS=Staphylococcus aureus (strain COL) GN=cysK PE=3 SV=1 47 302 4.0E-12
sp|P56067|CYSM_HELPY Cysteine synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=cysM PE=1 SV=1 47 280 2.0E-11
sp|P87131|CYSK2_SCHPO Cysteine synthase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cys12 PE=3 SV=1 44 225 2.0E-10
sp|P50867|CYSK_EMENI Cysteine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cysB PE=3 SV=2 29 213 3.0E-10
sp|O01592|CYSK3_CAEEL Cysteine synthase 3 OS=Caenorhabditis elegans GN=cysl-3 PE=1 SV=1 16 217 3.0E-10
sp|P9WP53|CYSM_MYCTU O-phosphoserine sulfhydrylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysM PE=1 SV=1 29 195 5.0E-10
sp|P9WP52|CYSM_MYCTO O-phosphoserine sulfhydrylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysM PE=3 SV=1 29 195 5.0E-10
sp|P63874|CYSM_MYCBO O-phosphoserine sulfhydrylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysM PE=3 SV=1 29 195 5.0E-10
sp|Q8XSQ0|SBNA_RALSO Putative siderophore biosynthesis protein SbnA OS=Ralstonia solanacearum (strain GMI1000) GN=sbnA PE=3 SV=1 29 234 1.0E-09
sp|Q1KLZ1|CAS2_MALDO L-3-cyanoalanine synthase 2, mitochondrial OS=Malus domestica GN=CAS2 PE=1 SV=1 44 299 3.0E-09
sp|D1GUM7|SBNA_STAA0 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain TW20 / 0582) GN=sbnA PE=3 SV=1 23 302 4.0E-09
sp|A7WX68|SBNA_STAA1 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=sbnA PE=3 SV=1 23 302 4.0E-09
sp|A6TXQ1|SBNA_STAA2 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain JH1) GN=sbnA PE=3 SV=1 23 302 4.0E-09
sp|Q2FKE3|SBNA_STAA3 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain USA300) GN=sbnA PE=3 SV=2 23 302 4.0E-09
sp|D3ERF5|SBNA_STAA4 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain 04-02981) GN=sbnA PE=3 SV=1 23 302 4.0E-09
sp|D2N3G7|SBNA_STAA5 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain MRSA ST398 / isolate S0385) GN=sbnA PE=3 SV=1 23 302 4.0E-09
sp|Q2G1N3|SBNA_STAA8 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain NCTC 8325) GN=sbnA PE=2 SV=2 23 302 4.0E-09
sp|Q5HJQ3|SBNA_STAAC Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain COL) GN=sbnA PE=3 SV=2 23 302 4.0E-09
sp|D0K799|SBNA_STAAD Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain ED98) GN=sbnA PE=3 SV=2 23 302 4.0E-09
sp|A6QDA0|SBNA_STAAE Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain Newman) GN=sbnA PE=3 SV=1 23 302 4.0E-09
sp|Q932K9|SBNA_STAAM Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=sbnA PE=3 SV=1 23 302 4.0E-09
sp|Q6GKI9|SBNA_STAAR Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain MRSA252) GN=sbnA PE=3 SV=1 23 302 4.0E-09
sp|Q6GD09|SBNA_STAAS Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain MSSA476) GN=sbnA PE=3 SV=1 23 302 4.0E-09
sp|A8YZ41|SBNA_STAAT Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=sbnA PE=3 SV=1 23 302 4.0E-09
sp|Q7A1Z6|SBNA_STAAW Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain MW2) GN=sbnA PE=3 SV=1 23 302 4.0E-09
sp|A5INY7|SBNA_STAA9 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain JH9) GN=sbnA PE=3 SV=1 23 302 4.0E-09
sp|Q76MX2|CAS1_SOLTU Bifunctional L-3-cyanoalanine synthase/cysteine synthase 1, mitochondrial OS=Solanum tuberosum GN=PCAS-1 PE=1 SV=1 44 282 5.0E-09
sp|Q99X99|SBNA_STAAN Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain N315) GN=sbnA PE=3 SV=1 23 216 5.0E-09
sp|Q1KLZ2|CAS1_MALDO L-3-cyanoalanine synthase 1, mitochondrial OS=Malus domestica GN=CAS1 PE=1 SV=1 44 299 9.0E-09
sp|Q9YBL2|CYSO_AERPE Protein CysO OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=cysO PE=1 SV=3 27 280 1.0E-08
sp|Q9ZMW6|CYSM_HELPJ Cysteine synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=cysM PE=3 SV=1 47 275 2.0E-08
sp|Q54CN7|CYSK_DICDI Cysteine synthase OS=Dictyostelium discoideum GN=cysK PE=3 SV=1 44 217 3.0E-08
sp|Q43153|CYSC_SPIOL Bifunctional L-3-cyanoalanine synthase/cysteine synthase, mitochondrial OS=Spinacia oleracea GN=CYSC PE=1 SV=1 44 299 3.0E-08
sp|Q9FS29|CAS2_SOLTU Bifunctional L-3-cyanoalanine synthase/cysteine synthase 2, mitochondrial OS=Solanum tuberosum GN=PCAS-2 PE=1 SV=1 44 299 4.0E-08
sp|O34476|CYSM_BACSU Probable cysteine synthase OS=Bacillus subtilis (strain 168) GN=ytkP PE=3 SV=1 29 294 4.0E-08
sp|P32582|CBS_YEAST Cystathionine beta-synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYS4 PE=1 SV=1 24 291 5.0E-08
sp|P32260|CYSKP_SPIOL Cysteine synthase, chloroplastic/chromoplastic OS=Spinacia oleracea GN=CYSK PE=1 SV=2 47 280 6.0E-08
sp|Q9S757|CYSC1_ARATH Bifunctional L-3-cyanoalanine synthase/cysteine synthase C1, mitochondrial OS=Arabidopsis thaliana GN=CYSC1 PE=1 SV=1 47 282 7.0E-08
sp|Q5XAQ3|CYSK_STRP6 Cysteine synthase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=cysK PE=1 SV=3 29 297 9.0E-08
sp|P53206|CYSK_YEAST Putative cysteine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR012W PE=1 SV=1 29 186 1.0E-07
sp|P32232|CBS_RAT Cystathionine beta-synthase OS=Rattus norvegicus GN=Cbs PE=1 SV=3 29 280 2.0E-07
sp|Q91WT9|CBS_MOUSE Cystathionine beta-synthase OS=Mus musculus GN=Cbs PE=1 SV=3 29 280 3.0E-07
sp|O67507|CYSM_AQUAE Cysteine synthase OS=Aquifex aeolicus (strain VF5) GN=cysM PE=3 SV=1 29 186 1.0E-06
sp|P38076|CYSK_WHEAT Cysteine synthase OS=Triticum aestivum GN=CYS1 PE=2 SV=1 46 280 2.0E-06
sp|Q00834|CYSK_SPIOL Cysteine synthase OS=Spinacia oleracea PE=1 SV=1 46 280 3.0E-06
sp|O59701|CYSK1_SCHPO Cysteine synthase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cys11 PE=3 SV=1 36 212 4.0E-06
sp|Q9XEA8|CYSK2_ORYSJ Cysteine synthase OS=Oryza sativa subsp. japonica GN=RCS3 PE=2 SV=1 46 280 5.0E-06
sp|Q9XEA6|CYSK1_ORYSJ Cysteine synthase OS=Oryza sativa subsp. japonica GN=RCS1 PE=2 SV=2 46 299 6.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup310
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3254
Ophiocordyceps australis 1348a (Ghana) OphauG2|6063
Ophiocordyceps australis map64 (Brazil) OphauB2|2347
Ophiocordyceps australis map64 (Brazil) OphauB2|7534
Ophiocordyceps camponoti-floridani Ophcf2|04932
Ophiocordyceps camponoti-rufipedis Ophun1|3811 (this protein)
Ophiocordyceps kimflemingae Ophio5|8302
Ophiocordyceps subramaniannii Hirsu2|1240
Ophiocordyceps subramaniannii Hirsu2|9597

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3811
MMGAAMLNVYRGPDAVRDYLDPDSSPPLPLVEIPDRLNPHRELGVRIYAKMMSMHPVNNVKAIPALNLLANGIEP
GKTKTVVEYSSGSTVLSMSLIARALYGVNDVRAFLSNKTSLAKIRLMQLFGIDITLFGGPSQPEPVDERGGIRAA
HRMAQESASTVNPNQYGNDDNWKAHVKWTGPQILKQLPEINVICAGMGTSGTMTGLGTYFKQAKPSVFRLGVCTA
AGDRVPGPRSYALLAPVEFPWRQAVDEIEEMGSHESFALSLDLIRNGIVCGPSSGFNLGGLFSFIEKRKADGTLR
SLAGSDGQIHCVFLCCDLPYPYVNEYFDKLGDSYFCSIHNEELIGVDSYRYDEKWERDASDALDDFFYLTKTTVS
KNDNDILTSKLDNLIQPKPETIVIDLRQPSDFARFSLPSSTNIPQVESSTASPFSDPSVLRSLWLRLEDTFKTPA
DPTLLDGRRILVLCYDGDSARVATSVLRARGHQADSIRGGFGALRALLAEAEGSSGLAGLEMVALPSQEAGCLAV
AVQTVESASGKHYRMRKTVILCFIHGFKGDEKTFGENLRFTEDLRTAVAQKLPRVDVRVLVYPTLEDKVIDLEVA
AGTKSPTVEPSVRTVLVGHSMGGIVAAETVIGLASDKAIYSEDGIDKASSSSLNGLMFPYVQGVLALDTPFLGIS
PGVVAHGAEEHYQNAASAVSQLSGLSDMFWGGSSQTASTERALTTTSAAASTEGGWARWGKMAMYAGAAGAVAAG
GAAAWMNREQLGSGWTWASSHLEFVGCLGRPEQLKKRVACMVQIADELSVGFANLYTRLGKGASSSTGISVAGTV
LGRERTFCNLPKAMRAGYWAEAVNEVAADEARAHMNMFEPEKNPGYEASKGSSQRLS*
Coding >Ophun1|3811
ATGATGGGAGCCGCCATGCTCAACGTCTACCGGGGCCCTGATGCCGTTCGAGACTATCTCGACCCGGACTCTTCG
CCGCCGTTGCCTCTGGTTGAGATACCGGATCGGCTTAACCCGCATCGTGAGCTGGGCGTGCGCATCTACGCCAAG
ATGATGTCGATGCATCCTGTCAATAACGTCAAGGCCATTCCCGCTCTGAACCTTCTCGCCAACGGCATCGAGCCG
GGAAAGACCAAGACGGTTGTCGAGTATAGCTCCGGGTCGACGGTGCTGTCCATGTCGCTCATCGCCCGCGCTCTG
TACGGAGTCAACGATGTGAGAGCCTTCTTGAGCAATAAGACGAGTCTGGCCAAGATACGGCTTATGCAGCTGTTT
GGCATCGACATCACGCTGTTCGGTGGTCCGTCGCAACCGGAGCCGGTAGATGAGCGCGGTGGCATCCGGGCTGCT
CATAGGATGGCGCAGGAGTCGGCGTCGACGGTCAACCCGAATCAGTATGGCAACGATGACAACTGGAAAGCCCAT
GTCAAATGGACCGGGCCGCAGATCCTCAAGCAACTACCCGAGATCAACGTCATATGCGCCGGCATGGGCACTTCA
GGCACCATGACCGGACTCGGCACGTATTTCAAACAGGCCAAGCCATCCGTCTTCCGGCTCGGAGTGTGCACCGCA
GCCGGAGATCGGGTTCCAGGCCCGCGATCATACGCGCTGCTCGCACCCGTCGAGTTCCCCTGGCGGCAGGCGGTC
GATGAGATTGAGGAGATGGGCTCGCATGAATCGTTTGCGCTATCACTGGACCTCATCCGCAACGGCATCGTTTGC
GGGCCATCGTCTGGCTTTAACCTTGGCGGCTTGTTCAGCTTCATCGAGAAGCGCAAGGCTGATGGTACGCTGCGG
TCGCTGGCTGGTTCTGATGGCCAGATCCATTGCGTCTTTTTGTGCTGCGACTTGCCTTATCCCTATGTTAACGAA
TACTTTGACAAGCTGGGGGACTCTTACTTTTGTTCCATCCACAACGAGGAGCTCATCGGCGTCGACTCATATCGG
TACGATGAAAAATGGGAGAGAGACGCGTCCGACGCCCTCGACGACTTCTTCTACCTCACCAAGACGACCGTCAGC
AAAAACGACAACGATATACTGACATCAAAGCTAGACAACCTCATCCAACCAAAGCCCGAAACCATCGTCATCGAC
CTCCGCCAACCCTCCGACTTCGCCCGCTTCAGCCTCCCCTCCTCAACCAACATACCCCAAGTCGAGAGCTCAACC
GCCAGCCCCTTCTCCGACCCAAGCGTCCTCCGCTCCCTCTGGCTCCGGCTCGAAGACACCTTCAAGACGCCCGCG
GACCCGACGCTCCTCGACGGGAGGCGCATCCTCGTCCTCTGCTACGACGGTGATAGCGCGCGCGTTGCCACGAGC
GTCTTGCGCGCCAGGGGCCATCAGGCTGATAGCATTCGCGGCGGCTTTGGGGCGCTGAGGGCTTTGCTGGCTGAA
GCGGAGGGTTCGTCTGGGTTGGCGGGCTTGGAGATGGTTGCTTTGCCGTCGCAGGAGGCTGGATGCTTGGCTGTA
GCTGTTCAGACTGTCGAGTCGGCCTCAGGAAAGCACTACAGGATGCGGAAGACGGTGATACTGTGCTTCATCCAC
GGCTTCAAGGGAGACGAAAAGACCTTTGGGGAAAACCTCCGCTTCACCGAGGACCTGCGAACGGCAGTGGCGCAG
AAGCTGCCGCGGGTCGACGTCCGAGTGCTGGTCTATCCGACGCTGGAGGACAAGGTGATTGACCTCGAGGTCGCG
GCAGGGACCAAGTCGCCGACGGTAGAGCCCTCTGTTCGAACGGTGCTGGTTGGGCATTCGATGGGGGGCATCGTT
GCGGCTGAGACGGTCATCGGGCTGGCGTCGGACAAGGCGATATACTCGGAAGACGGCATCGACAAGGCATCTTCG
TCGTCGTTGAACGGACTGATGTTTCCGTACGTGCAGGGCGTGCTGGCTCTCGATACACCGTTCCTAGGGATTTCG
CCTGGGGTGGTGGCTCATGGAGCGGAGGAGCATTATCAGAATGCCGCTTCGGCTGTCTCCCAGCTCAGCGGGCTT
TCCGACATGTTCTGGGGGGGATCATCGCAGACGGCTTCCACCGAGAGGGCTCTGACGACGACCAGCGCGGCGGCT
TCCACCGAGGGCGGGTGGGCTCGCTGGGGGAAGATGGCCATGTACGCCGGGGCAGCGGGCGCAGTGGCAGCAGGC
GGAGCGGCAGCCTGGATGAACAGAGAGCAGCTAGGTTCAGGCTGGACGTGGGCCTCGTCGCACCTCGAGTTCGTG
GGCTGTCTGGGGCGGCCGGAGCAGTTGAAGAAGAGGGTTGCCTGCATGGTGCAGATTGCTGACGAGCTGTCTGTC
GGCTTCGCCAACCTGTACACGAGGCTTGGGAAGGGGGCTTCTTCGTCGACGGGGATATCCGTGGCGGGGACGGTG
CTGGGGAGGGAGAGGACGTTTTGTAATCTGCCCAAGGCTATGAGGGCGGGATATTGGGCCGAGGCTGTGAATGAG
GTTGCTGCTGATGAGGCTAGGGCGCATATGAACATGTTTGAGCCGGAGAAGAATCCGGGTTATGAGGCGTCCAAG
GGATCATCACAGAGACTGAGTTGA
Transcript >Ophun1|3811
ATGATGGGAGCCGCCATGCTCAACGTCTACCGGGGCCCTGATGCCGTTCGAGACTATCTCGACCCGGACTCTTCG
CCGCCGTTGCCTCTGGTTGAGATACCGGATCGGCTTAACCCGCATCGTGAGCTGGGCGTGCGCATCTACGCCAAG
ATGATGTCGATGCATCCTGTCAATAACGTCAAGGCCATTCCCGCTCTGAACCTTCTCGCCAACGGCATCGAGCCG
GGAAAGACCAAGACGGTTGTCGAGTATAGCTCCGGGTCGACGGTGCTGTCCATGTCGCTCATCGCCCGCGCTCTG
TACGGAGTCAACGATGTGAGAGCCTTCTTGAGCAATAAGACGAGTCTGGCCAAGATACGGCTTATGCAGCTGTTT
GGCATCGACATCACGCTGTTCGGTGGTCCGTCGCAACCGGAGCCGGTAGATGAGCGCGGTGGCATCCGGGCTGCT
CATAGGATGGCGCAGGAGTCGGCGTCGACGGTCAACCCGAATCAGTATGGCAACGATGACAACTGGAAAGCCCAT
GTCAAATGGACCGGGCCGCAGATCCTCAAGCAACTACCCGAGATCAACGTCATATGCGCCGGCATGGGCACTTCA
GGCACCATGACCGGACTCGGCACGTATTTCAAACAGGCCAAGCCATCCGTCTTCCGGCTCGGAGTGTGCACCGCA
GCCGGAGATCGGGTTCCAGGCCCGCGATCATACGCGCTGCTCGCACCCGTCGAGTTCCCCTGGCGGCAGGCGGTC
GATGAGATTGAGGAGATGGGCTCGCATGAATCGTTTGCGCTATCACTGGACCTCATCCGCAACGGCATCGTTTGC
GGGCCATCGTCTGGCTTTAACCTTGGCGGCTTGTTCAGCTTCATCGAGAAGCGCAAGGCTGATGGTACGCTGCGG
TCGCTGGCTGGTTCTGATGGCCAGATCCATTGCGTCTTTTTGTGCTGCGACTTGCCTTATCCCTATGTTAACGAA
TACTTTGACAAGCTGGGGGACTCTTACTTTTGTTCCATCCACAACGAGGAGCTCATCGGCGTCGACTCATATCGG
TACGATGAAAAATGGGAGAGAGACGCGTCCGACGCCCTCGACGACTTCTTCTACCTCACCAAGACGACCGTCAGC
AAAAACGACAACGATATACTGACATCAAAGCTAGACAACCTCATCCAACCAAAGCCCGAAACCATCGTCATCGAC
CTCCGCCAACCCTCCGACTTCGCCCGCTTCAGCCTCCCCTCCTCAACCAACATACCCCAAGTCGAGAGCTCAACC
GCCAGCCCCTTCTCCGACCCAAGCGTCCTCCGCTCCCTCTGGCTCCGGCTCGAAGACACCTTCAAGACGCCCGCG
GACCCGACGCTCCTCGACGGGAGGCGCATCCTCGTCCTCTGCTACGACGGTGATAGCGCGCGCGTTGCCACGAGC
GTCTTGCGCGCCAGGGGCCATCAGGCTGATAGCATTCGCGGCGGCTTTGGGGCGCTGAGGGCTTTGCTGGCTGAA
GCGGAGGGTTCGTCTGGGTTGGCGGGCTTGGAGATGGTTGCTTTGCCGTCGCAGGAGGCTGGATGCTTGGCTGTA
GCTGTTCAGACTGTCGAGTCGGCCTCAGGAAAGCACTACAGGATGCGGAAGACGGTGATACTGTGCTTCATCCAC
GGCTTCAAGGGAGACGAAAAGACCTTTGGGGAAAACCTCCGCTTCACCGAGGACCTGCGAACGGCAGTGGCGCAG
AAGCTGCCGCGGGTCGACGTCCGAGTGCTGGTCTATCCGACGCTGGAGGACAAGGTGATTGACCTCGAGGTCGCG
GCAGGGACCAAGTCGCCGACGGTAGAGCCCTCTGTTCGAACGGTGCTGGTTGGGCATTCGATGGGGGGCATCGTT
GCGGCTGAGACGGTCATCGGGCTGGCGTCGGACAAGGCGATATACTCGGAAGACGGCATCGACAAGGCATCTTCG
TCGTCGTTGAACGGACTGATGTTTCCGTACGTGCAGGGCGTGCTGGCTCTCGATACACCGTTCCTAGGGATTTCG
CCTGGGGTGGTGGCTCATGGAGCGGAGGAGCATTATCAGAATGCCGCTTCGGCTGTCTCCCAGCTCAGCGGGCTT
TCCGACATGTTCTGGGGGGGATCATCGCAGACGGCTTCCACCGAGAGGGCTCTGACGACGACCAGCGCGGCGGCT
TCCACCGAGGGCGGGTGGGCTCGCTGGGGGAAGATGGCCATGTACGCCGGGGCAGCGGGCGCAGTGGCAGCAGGC
GGAGCGGCAGCCTGGATGAACAGAGAGCAGCTAGGTTCAGGCTGGACGTGGGCCTCGTCGCACCTCGAGTTCGTG
GGCTGTCTGGGGCGGCCGGAGCAGTTGAAGAAGAGGGTTGCCTGCATGGTGCAGATTGCTGACGAGCTGTCTGTC
GGCTTCGCCAACCTGTACACGAGGCTTGGGAAGGGGGCTTCTTCGTCGACGGGGATATCCGTGGCGGGGACGGTG
CTGGGGAGGGAGAGGACGTTTTGTAATCTGCCCAAGGCTATGAGGGCGGGATATTGGGCCGAGGCTGTGAATGAG
GTTGCTGCTGATGAGGCTAGGGCGCATATGAACATGTTTGAGCCGGAGAAGAATCCGGGTTATGAGGCGTCCAAG
GGATCATCACAGAGACTGAGTTGA
Gene >Ophun1|3811
ATGATGGGAGCCGCCATGCTCAACGTCTACCGGGGCCCTGATGCCGTTCGAGACTATCTCGACCCGGACTCTTCG
CCGCCGTTGCCTCTGGTTGAGATACCGGATCGGCTTAACCCGCATCGTGAGCTGGGCGTGCGCATCTACGCCAAG
ATGATGTCGATGCATCCTGTCAATAACGTCAAGGCCATTCCCGGTAGGTTAACTTTCTTTGTTTCGGTAGCGTGT
GGCTGCTTCGAGTGGTGGTTGACTGGAGAGACGGCAGCTCTGAACCTTCTCGCCAACGGCATCGAGCCGGGAAAG
ACCAAGACGGTTGTCGAGTATAGCTCCGGGTCGACGGTGCTGTCCATGTCGCTCATCGCCCGCGCTCTGTACGGA
GTCAACGATGTGAGAGCCTTCTTGAGCAATAAGACGAGTCTGGCCAAGATACGGCTTATGCAGCTGTTTGGCATC
GACATGTTGGTTCCCCATTCCACTTCAACTCTTGCCCATCTTTCTCACAGCTAGAAGCACGCTGTTCGGTGGTCC
GTCGCAACCGGAGCCGGTAGATGAGCGCGGTGGCATCCGGGCTGCTCATAGGATGGCGCAGGAGTCGGCGTCGAC
GGTCAACCCGAATCAGTATGGCAACGATGACGTGTGTGTTCCGACTTCCCCTTTCTTGCTCCGTCGACTGAGATG
GAAATGATGGTTCAGAACTGGAAAGCCCATGTCAAATGGACCGGGCCGCAGATCCTCAAGCAACTACCCGAGATC
AACGTCATATGCGCCGGCATGGGCACTTCAGGTGAGGAAGCAAGATGTGTGACTTCGATCATCGACTGACAGCTC
ATCACAGGCACCATGACCGGACTCGGCACGTATTTCAAACAGGCCAAGCCATCCGTCTTCCGGCTCGGGTATGTG
ACTCCCAGCTTTATCCTCCCGAAGGGACCAACTGTTGAACCAAGAGCAGAGTGTGCACCGCAGCCGGAGATCGGG
TTCCAGGCCCGCGATCATACGCGCTGCTCGCACCCGTCGAGTTCCCCTGGCGGCAGGCGGTCGATGAGATTGAGG
AGATGGGCTCGCATGAATCGTTTGCGCTATCACTGGACCTCATCCGCAACGGCATCGTTTGCGGGCCATCGTCTG
GCTTTAACCTTGGCGGCTTGTTCAGCTTCATCGAGAAGCGCAAGGCTGATGGTACGCTGCGGTCGCTGGCTGGTT
CTGATGGCCAGATCCATTGCGTCTTTTTGTGCTGCGACTTGCCTTATCCCTATGTTAACGAATACTTTGACAAGC
TGGGGGACTCTTACTTTTGTTCCATCCACAACGAGGTTCGTCTCTGTTCATCCGTGAAGGAAGAATTAGTTTAAC
ATTTTGTTTCCAGGAGCTCATCGGCGTCGACTCATATCGGTACGATGAAAAATGGGAGAGAGACGCGTCCGACGC
CCTCGACGACTTCTTCTACCTCACCAAGACGACCGTCAGCAAAAACGACAACGATATACTGACATCAAAGCTAGA
CAACCTCATCCAACCAAAGCCCGAAACCATCGTCATCGACCTCCGCCAACCCTCCGACTTCGCCCGCTTCAGCCT
CCCCTCCTCAACCAACATACCCCAAGTCGAGAGCTCAACCGCCAGCCCCTTCTCCGACCCAAGCGTCCTCCGCTC
CCTCTGGCTCCGGCTCGAAGACACCTTCAAGACGCCCGCGGACCCGACGCTCCTCGACGGGAGGCGCATCCTCGT
CCTCTGCTACGACGGTGATAGCGCGCGCGTTGCCACGAGCGTCTTGCGCGCCAGGGGCCATCAGGCTGATAGCAT
TCGCGGCGGCTTTGGGGCGCTGAGGGCTTTGCTGGCTGAAGCGGAGGGTTCGTCTGGGTTGGCGGGCTTGGAGAT
GGTTGCTTTGCCGTCGCAGGAGGCTGGATGCTTGGCTGTAGCTGTTCAGACTGTCGAGTCGGCCTCAGGGTAGGA
GGGAGCATGACATTTTACATACTTAGAAACTAGGATTATATAATTTAGCAAGAGGCTTGCACAGTACCAACTGAG
GTTGATGCACCCGGTCGAGTAGTATAGAGGTTAGTACATCATGCTCACACAGCCTGGCTGCGGGTTCCGTGAAGT
CCCGGGTTCAATTCCCGGCTCGACTATGCTTTTTGCCGACTTGACTAAATCATTGATCCGTCACCTTCAGGCTTC
AGGAGACATTTTTTATTCCCAGAAACACGTTTCTAGACGGTGAGGTATCTTGTTCAAGTTTTGTCTGCCTGCTTT
CTGTCGCGGAAGAAAAGCCGACTCGGAACAGGCACGATTAGTCATGGGGAACTGACGACATGCGTCGAGACTGAA
GGCGGCGCCGTGGCGAACACAAAGAAAGCACTACAGGATGCGGAAGACGGTGATACTGTGCTTCATCCACGGCTT
CAAGGTGCCTGAAACCCTTCTATTCACTCCATCTACCGGCTGACGGACGACAACGGCACAGGGAGACGAAAAGAC
CTTTGGGGAAAACCTCCGCTTCACCGAGGACCTGCGAACGGCAGTGGCGCAGAAGCTGCCGCGGGTCGACGTCCG
AGTGCTGGTCTATCCGACGTACGAGACACGCGGCGACCTTGGAGAATGTGTGAGCCGATTTCGAAGCTGGTTGGC
AGTTGATCCTCCCCCCCCCCCCACGGGACTCTGCGCTGATGCTCGCCAGGCTGGAGGACAAGGTGATTGACCTCG
AGGTCGCGGCAGGGACCAAGTCGCCGACGGTAGAGCCCTCTGTTCGAACGGTGCTGGTTGGGCATTCGATGGGGG
GCATCGTTGCGGCTGAGACGGTCATCGGGCTGGCGTCGGACAAGGCGATATACTCGGAAGACGGCATCGACAAGG
CATCTTCGTCGTCGTTGAACGGACTGATGTTTCCGTACGTGCAGGGCGTGCTGGCTCTCGATACACCGTTCCTAG
GGATTTCGCCTGGGGTGGTGGCTCATGGAGCGGAGGAGCATTATCAGAATGCCGCTTCGGCTGTCTCCCAGCTCA
GCGGGCTTTCCGACATGTTCTGGGGGGGATCATCGCAGACGGCTTCCACCGAGAGGGCTCTGACGACGACCAGCG
CGGCGGCTTCCACCGAGGGCGGGTGGGCTCGCTGGGGGAAGATGGCCATGTACGCCGGGGCAGCGGGCGCAGTGG
CAGCAGGCGGAGCGGCAGCCTGGATGAACAGAGAGCAGCTAGGTTCAGGCTGGACGTGGGCCTCGTCGCACCTCG
AGTTCGTGGGCTGTCTGGGGCGGCCGGAGCAGTTGAAGAAGAGGGTTGCCTGCATGGTGCAGATTGCTGACGAGC
TGTCTGTCGGCTTCGCCAACCTGTACACGAGGCTTGGGAAGGGGGCTTCTTCGTCGACGGGGATATCCGTGGCGG
GGACGGTGCTGGGGAGGGAGAGGACGTTTTGTAATCTGCCCAAGGCTATGAGGGCGGGATATTGGGCCGAGGCTG
TGAATGAGGTTGCTGCTGATGAGGCTAGGGCGCATATGAGTGGGTTCTTGATCTTTTTTTGGCTTCGTTGTTTTG
CTTTTGGGGCTGACTGCTGCAGACATGTTTGAGCCGGAGAAGAATCCGGGGTATGAGGCTTTGACGGGGGCTGCT
GCTGGCTTGATTGGGGGGTGGTTTCGGAATGAGTGGTATGAGGGGGGGGAGGGGGAGGGTGGTGAGCTGCTTGAG
TTGTAGGATGTGGTTTGGGAGGGAAGATTGATGATGGAGTTGCTGGGAGTGTGTTGAATCGGGTGTTTAGGTCGA
GGACGGGCAGAGTACAGGCCGTTTCCGGTGTTGAGGCTAGTTATGAGGCGTCCAAGGGATCATCACAGAGACTGA
GTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail