Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|381
Gene name
LocationContig_110:14526..16299
Strand-
Gene length (bp)1773
Transcript length (bp)1380
Coding sequence length (bp)1380
Protein length (aa) 460

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14479 HeLo Prion-inhibition and propagation 4.9E-07 11 101

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4738
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3129
Ophiocordyceps australis 1348a (Ghana) OphauG2|5490
Ophiocordyceps australis map64 (Brazil) OphauB2|1466
Ophiocordyceps camponoti-floridani Ophcf2|05890
Ophiocordyceps camponoti-rufipedis Ophun1|381 (this protein)
Ophiocordyceps kimflemingae Ophio5|1503
Ophiocordyceps kimflemingae Ophio5|7861

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|381
MSLDLQIGAAGLGLGAFSTALDLLTSCSKIYNLWKSAAGLDAQLETLRARLLLQQALLEQWQRDWLDASVTGQAL
HRRRLLKQHESTVDHTLRAVEQQLHKLEPLREAASGHKKDLSAMERLQWVTQKAASSEKALADIELLLSSLYRLF
PVWTPNPNASAAMAALDFISDAVSTSPAASTLSKAMSLRQLRHGLDQDLEKRIAGFLQSMPKTDLDLTSNQVEIT
EHDATTAGLRSFGLLDKTRRVMVEWKGYDSSWRGQKGIRMRGRIRNIAQFLAAESKPDELLTPRCVGVFDDAERS
RYGFVFSLPSGGDSKLVSLKQLLDNKTPETLPSLEDRYRIAYQVGLSLAMLHTAGWLHKSIRSHNVLFGVRNGRP
IWTRPYLAGFDFSRPDLADESSEKPEQSARFNLYRHPSAQGGPGEDYRKAFDIYSFGVVLVEVGLWRSAWKMWGD
DSLARFSPS*
Coding >Ophun1|381
ATGTCCCTGGATCTTCAGATCGGGGCAGCGGGCCTCGGCCTCGGCGCCTTCAGCACAGCACTAGACCTACTCACA
TCTTGCTCAAAGATATACAACCTATGGAAGTCAGCCGCGGGACTCGACGCCCAGCTCGAAACGCTCCGCGCCCGA
TTGCTGCTCCAGCAGGCGCTGCTCGAACAATGGCAGCGAGATTGGCTGGATGCGTCCGTCACGGGGCAGGCCCTC
CACAGACGACGGCTCCTGAAGCAGCACGAGTCAACAGTTGATCATACTCTCAGAGCCGTCGAGCAGCAACTTCAC
AAGCTGGAGCCACTACGAGAGGCTGCGAGCGGACACAAAAAGGACCTCTCGGCCATGGAGCGACTACAGTGGGTG
ACGCAAAAGGCTGCGTCGAGTGAAAAGGCGCTGGCAGATATAGAGCTGCTTCTCTCGTCGCTATACAGGCTCTTC
CCCGTCTGGACGCCAAACCCAAATGCGTCTGCGGCCATGGCAGCGCTGGATTTCATCTCCGACGCCGTCAGCACA
TCTCCAGCAGCATCGACGCTGAGCAAAGCCATGAGTCTTCGCCAGCTTCGACACGGACTGGATCAGGATCTCGAG
AAGCGAATCGCGGGATTCCTCCAGTCCATGCCCAAGACAGATCTGGACCTGACGTCCAACCAGGTTGAAATCACC
GAGCACGATGCCACTACAGCCGGGCTCCGAAGCTTCGGCCTCCTCGACAAGACGAGAAGAGTCATGGTAGAGTGG
AAGGGCTACGACTCCAGCTGGCGAGGGCAAAAGGGCATCCGGATGAGAGGCCGGATCCGCAACATTGCGCAGTTT
CTGGCTGCCGAGTCTAAGCCAGACGAGTTGCTGACGCCCCGGTGCGTCGGCGTCTTTGACGATGCTGAACGCAGT
CGCTACGGCTTCGTCTTCTCGTTGCCTTCGGGTGGGGATTCGAAGCTGGTATCGTTAAAGCAGCTGCTCGACAAC
AAGACGCCCGAGACGCTTCCAAGTCTCGAGGACCGATACCGAATCGCGTATCAGGTTGGGCTATCACTCGCCATG
CTTCATACAGCAGGTTGGCTTCACAAGAGCATCCGTAGTCACAACGTCCTCTTCGGCGTCCGAAACGGCCGACCC
ATCTGGACCCGTCCGTACCTGGCAGGCTTCGACTTTTCTCGCCCAGACTTGGCGGACGAATCCTCAGAGAAGCCA
GAGCAAAGCGCACGCTTCAATCTGTACCGTCACCCGTCTGCACAGGGTGGTCCAGGCGAAGACTACCGCAAGGCA
TTCGATATCTACAGCTTCGGCGTGGTGCTGGTCGAGGTCGGGCTGTGGCGGTCAGCGTGGAAGATGTGGGGAGAC
GACTCGCTCGCTCGCTTCAGTCCCTCATAG
Transcript >Ophun1|381
ATGTCCCTGGATCTTCAGATCGGGGCAGCGGGCCTCGGCCTCGGCGCCTTCAGCACAGCACTAGACCTACTCACA
TCTTGCTCAAAGATATACAACCTATGGAAGTCAGCCGCGGGACTCGACGCCCAGCTCGAAACGCTCCGCGCCCGA
TTGCTGCTCCAGCAGGCGCTGCTCGAACAATGGCAGCGAGATTGGCTGGATGCGTCCGTCACGGGGCAGGCCCTC
CACAGACGACGGCTCCTGAAGCAGCACGAGTCAACAGTTGATCATACTCTCAGAGCCGTCGAGCAGCAACTTCAC
AAGCTGGAGCCACTACGAGAGGCTGCGAGCGGACACAAAAAGGACCTCTCGGCCATGGAGCGACTACAGTGGGTG
ACGCAAAAGGCTGCGTCGAGTGAAAAGGCGCTGGCAGATATAGAGCTGCTTCTCTCGTCGCTATACAGGCTCTTC
CCCGTCTGGACGCCAAACCCAAATGCGTCTGCGGCCATGGCAGCGCTGGATTTCATCTCCGACGCCGTCAGCACA
TCTCCAGCAGCATCGACGCTGAGCAAAGCCATGAGTCTTCGCCAGCTTCGACACGGACTGGATCAGGATCTCGAG
AAGCGAATCGCGGGATTCCTCCAGTCCATGCCCAAGACAGATCTGGACCTGACGTCCAACCAGGTTGAAATCACC
GAGCACGATGCCACTACAGCCGGGCTCCGAAGCTTCGGCCTCCTCGACAAGACGAGAAGAGTCATGGTAGAGTGG
AAGGGCTACGACTCCAGCTGGCGAGGGCAAAAGGGCATCCGGATGAGAGGCCGGATCCGCAACATTGCGCAGTTT
CTGGCTGCCGAGTCTAAGCCAGACGAGTTGCTGACGCCCCGGTGCGTCGGCGTCTTTGACGATGCTGAACGCAGT
CGCTACGGCTTCGTCTTCTCGTTGCCTTCGGGTGGGGATTCGAAGCTGGTATCGTTAAAGCAGCTGCTCGACAAC
AAGACGCCCGAGACGCTTCCAAGTCTCGAGGACCGATACCGAATCGCGTATCAGGTTGGGCTATCACTCGCCATG
CTTCATACAGCAGGTTGGCTTCACAAGAGCATCCGTAGTCACAACGTCCTCTTCGGCGTCCGAAACGGCCGACCC
ATCTGGACCCGTCCGTACCTGGCAGGCTTCGACTTTTCTCGCCCAGACTTGGCGGACGAATCCTCAGAGAAGCCA
GAGCAAAGCGCACGCTTCAATCTGTACCGTCACCCGTCTGCACAGGGTGGTCCAGGCGAAGACTACCGCAAGGCA
TTCGATATCTACAGCTTCGGCGTGGTGCTGGTCGAGGTCGGGCTGTGGCGGTCAGCGTGGAAGATGTGGGGAGAC
GACTCGCTCGCTCGCTTCAGTCCCTCATAG
Gene >Ophun1|381
ATGTCCCTGGATCTTCAGATCGGGGCAGCGGGCCTCGGCCTCGGCGCCTTCAGCACAGCACTAGACCTACTCACA
TCTTGCTCAAAGATATACAACCTATGGAAGTCAGCCGCGGGACTCGACGCCCAGCTCGAAACGCTCCGCGCCCGA
TTGCTGCTCCAGCAGGCGCTGCTCGAACAATGGCAGCGAGATTGGCTGGATGCGTCCGTCACGGGGCAGGCCCTC
CACAGACGACGGCTCCTGAAGCAGCACGAGTCAACAGTTGATCATACTCTCAGAGCCGTCGAGCAGCAACTTCAC
AAGCTGGAGCCACTACGAGAGGCTGCGAGCGGACACAAAAAGGACCTCTCGGCCATGGAGCGACTACAGTGGGTG
ACGCAAAAGGCTGCGTCGAGTGAAAAGGCGCTGGCAGATATAGAGCTGCTTCTCTCGTCGCTATACAGGCTCTTC
CCCGTCTGGACGCCAAACCCAAATGCGTCTGCGGCCATGGCAGCGCTGGATTTCATCTCCGACGCCGTCAGCACA
TCTCCAGCAGCATCGACGCTGAGCAAAGCCATGAGTCTTCGCCAGCTTCGACACGGACTGGATCAGGATCTCGAG
AAGCGAATCGCGGGATTCCTCCAGTCCATGCCCAAGACAGATCTGGACCTGACGTCCAACCAGGTTGAAATCACC
GAGCACGATGCCACTACAGCCGGGCTCCGAAGCTTCGGCCTCCTCGACAAGACGAGAAGAGTCATGGTAGAGTGG
AAGGGCTACGACTCCAGCTGGCGAGGGCAAAAGGGCATCCGGATGAGAGGCCGGATCCGCAACATTGCGCAGTTT
CTGGCTGCCGAGTCTAAGCCAGACGAGTTGCTGACGCCCCGGTGCGTCGGCGTCTTTGACGATGCTGAACGCAGT
CGCTACGGCTTCGTCTTCTCGTTGCCTTCGGGTGGGGATTCGAAGCTGGTATCGTTAAAGCAGCTGCTCGACAAC
AAGACGCCCGAGACGCTTCCAAGTCTCGAGGACCGATACCGAATCGCGTATCAGGTTGGGCTATCACTCGCCATG
CTTCATACAGCAGGTTGGCTTCACAAGAGCATCCGTAGTCACAACGTCCTCTTCGGCGTCCGAAACGGCCGACCC
ATCTGGACCCGTCCGTACCTGGCAGGCTTCGACTTTTCTCGCCCAGACTTGGCGGACGAATCCTCAGAGAAGCCA
GAGCAAAGCGCACGCTTCAATCTGTACCGTCACCCGTCTGCACAGGGTGGTCCAGGCGAAGACTACCGCAAGGCA
TTCGATATCTACAGCTTCGGCGTGGTGCTGGTCGAGGTCGGGCTGTGGCGGTCAGCGTGGAAGATGTGGGGAGAC
GGTATGACGGCGGTGGCGTTTAGGGATGGGCTTTTGGGGAGGGCGAGGGACTGGTTGGCTCATTCCATGGGAGGG
GTGTTTCAAGATGTGGTGGTTAGGTGTTTGGGGGGGCTGGAGGGAGAGGAGGTGAAGAAGGTTTTTTGTGTTGAG
GTTGTTGAGGTGTTGGGGAGGTTGACTGTGGATGGGTGATGGGAGAGGGAGCTGAATTGGCGTGGAAGTGGAAGA
GTTTGCCAGGTTGATGGTTGTAGGATACGTGAGTTGAAGAGTTGAGCCGGACTAATGGTTGAGATATGGAGTCCC
TGAAGTTGCGAAAGTTATGTTTAATGAGACGATGAGAGCTTGAACTCGCTCTCAATAGACGATGCAAAGAACACC
TTCATATACCTTTAAGCAGACTCGCTCGCTCGCTTCAGTCCCTCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail