Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3805
Gene name
LocationContig_341:5572..7890
Strand+
Gene length (bp)2318
Transcript length (bp)1581
Coding sequence length (bp)1581
Protein length (aa) 527

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 8.1E-10 410 500
PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain 3.4E-06 425 501
PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain 4.2E-05 445 505

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94340|YHM7_SCHPO Uncharacterized N-acetyltransferase C1271.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.07c PE=3 SV=1 361 517 7.0E-34
sp|Q18B70|ATSE_PEPD6 Acetyltransferase CD1211 OS=Peptoclostridium difficile (strain 630) GN=CD630_12110 PE=3 SV=1 373 521 4.0E-28
sp|Q54GF2|Y0199_DICDI Uncharacterized N-acetyltransferase DDB_G0290199 OS=Dictyostelium discoideum GN=DDB_G0290199 PE=3 SV=1 444 510 8.0E-15
sp|Q8CHQ9|CMLO2_MOUSE Probable N-acetyltransferase CML2 OS=Mus musculus GN=Cml2 PE=1 SV=1 399 507 2.0E-08
sp|P85118|CMLO2_RAT Probable N-acetyltransferase CML2 OS=Rattus norvegicus GN=Cml2 PE=3 SV=1 399 521 7.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94340|YHM7_SCHPO Uncharacterized N-acetyltransferase C1271.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.07c PE=3 SV=1 361 517 7.0E-34
sp|Q18B70|ATSE_PEPD6 Acetyltransferase CD1211 OS=Peptoclostridium difficile (strain 630) GN=CD630_12110 PE=3 SV=1 373 521 4.0E-28
sp|Q54GF2|Y0199_DICDI Uncharacterized N-acetyltransferase DDB_G0290199 OS=Dictyostelium discoideum GN=DDB_G0290199 PE=3 SV=1 444 510 8.0E-15
sp|Q8CHQ9|CMLO2_MOUSE Probable N-acetyltransferase CML2 OS=Mus musculus GN=Cml2 PE=1 SV=1 399 507 2.0E-08
sp|P85118|CMLO2_RAT Probable N-acetyltransferase CML2 OS=Rattus norvegicus GN=Cml2 PE=3 SV=1 399 521 7.0E-07
sp|Q9UHF3|NAT8B_HUMAN Putative N-acetyltransferase 8B OS=Homo sapiens GN=NAT8B PE=5 SV=1 422 508 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008080 N-acetyltransferase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0003674 molecular_function No
GO:0016410 N-acyltransferase activity No
GO:0016407 acetyltransferase activity No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016746 acyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.5

Transmembrane Domains

Domain # Start End Length
1 32 54 22
2 67 89 22
3 111 133 22
4 146 168 22
5 199 221 22
6 234 256 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3805
MGDRRRINEAVASGHVPPDISADFLAESRDGPAMVAIMLVTTLTAGLVICRLLARTLMLQRFGVDDGLALASLLT
LAAFVGLAMELIQLGSGRHYAYIQYVLPLSTVEATQVLDFAAHILYTVALLLCRVSGLAFYHRVCSLHRGFLVAI
QVVFGLLMAGFLPQLLLIVFHCRPVTALWPYGWEPWSEEFACLQWGVVYVTNSTISLTCDMLLFGIPVAMLRILE
MSQKRKIQLGCILLPGVAVVAISITRLVLVVIGQYMSWSYNALLTVEVSEIGATLIALSVPGVKPIVDRFLLGRG
TVLHMATAGGSRYVPNNKAGSLTSKHGTALSTLKLRSDYSVLGAETAANYGTELPDPAPTASFSIRPALWPSDLD
AVRACFGAYVEWLGEDLSFQGYAAELVALPGRYASPSGALLLAVGDDGDGVLLGCIAGRPLGSSSVGACEMKRLY
VYPEARGWGVSRALVRRLVSWAENEGYEEMVLDTLPRMSAAIGLYASEGFVVTEPYYHNPLPGTLYMAKRLGQHP
G*
Coding >Ophun1|3805
ATGGGCGACAGACGGCGCATCAACGAGGCCGTAGCATCAGGACACGTCCCCCCTGACATCAGCGCCGACTTCCTG
GCCGAAAGCCGCGACGGTCCAGCAATGGTAGCCATCATGCTCGTCACGACGCTGACAGCCGGCCTCGTCATCTGC
CGTCTTCTCGCCCGAACGCTGATGCTCCAACGGTTCGGCGTGGACGACGGCCTGGCCCTGGCCTCGCTCCTCACG
CTGGCCGCCTTCGTCGGTCTAGCCATGGAGCTCATCCAGCTCGGATCGGGAAGACACTACGCCTACATCCAGTAC
GTGCTCCCTCTGTCCACCGTCGAGGCGACGCAGGTGCTCGACTTTGCCGCCCACATCCTCTACACCGTCGCCTTG
CTGCTCTGCCGCGTCTCGGGCCTGGCGTTTTACCACCGCGTGTGCAGCTTGCATCGGGGCTTCCTCGTTGCCATA
CAGGTTGTCTTCGGCTTGTTGATGGCGGGCTTCTTGCCGCAGCTTTTGCTCATCGTCTTTCATTGTCGGCCGGTC
ACGGCGCTTTGGCCGTATGGGTGGGAGCCTTGGAGTGAGGAGTTTGCGTGTTTGCAGTGGGGGGTTGTCTATGTT
ACTAACTCGACGATTTCGTTGACGTGCGATATGCTGCTGTTTGGGATTCCGGTTGCTATGCTGCGGATCCTGGAG
ATGTCGCAGAAGCGCAAGATTCAGCTGGGTTGTATTCTGTTGCCGGGCGTTGCAGTCGTTGCCATCTCCATCACC
CGCCTGGTCCTCGTCGTCATCGGCCAATACATGTCCTGGAGCTACAACGCGCTCCTCACCGTCGAAGTCTCCGAG
ATCGGCGCAACCCTCATCGCCCTATCCGTCCCCGGCGTCAAGCCCATCGTCGACCGCTTCCTCCTCGGCCGGGGC
ACCGTCCTGCACATGGCCACGGCCGGCGGGTCGCGCTACGTGCCCAACAACAAGGCCGGCAGCCTGACCTCGAAG
CACGGGACGGCGCTGAGCACGCTGAAGCTGCGGTCTGATTACAGCGTTCTCGGGGCTGAGACGGCGGCCAACTAT
GGCACTGAGCTCCCCGATCCCGCCCCGACCGCCAGCTTCTCCATCCGACCGGCCCTCTGGCCGTCAGACCTAGAC
GCCGTCCGGGCCTGTTTCGGAGCCTACGTCGAGTGGTTAGGCGAAGATCTCTCCTTTCAAGGCTACGCAGCCGAG
CTGGTCGCCTTGCCCGGCCGATACGCGTCCCCTTCCGGTGCGCTGCTGCTGGCAGTCGGTGACGACGGCGATGGC
GTCCTCCTCGGCTGCATCGCCGGCAGGCCGCTCGGGTCGTCTTCGGTGGGCGCGTGCGAGATGAAGCGACTGTAT
GTCTATCCCGAGGCTCGTGGTTGGGGCGTCTCGCGTGCGTTGGTGAGGAGGCTTGTTTCGTGGGCTGAGAACGAG
GGCTACGAGGAGATGGTGCTGGATACGCTGCCGCGGATGAGTGCTGCCATCGGTCTTTATGCTTCCGAGGGCTTC
GTCGTCACGGAGCCGTACTATCATAATCCTCTTCCCGGGACTCTATACATGGCCAAGAGGCTGGGTCAACACCCC
GGATGA
Transcript >Ophun1|3805
ATGGGCGACAGACGGCGCATCAACGAGGCCGTAGCATCAGGACACGTCCCCCCTGACATCAGCGCCGACTTCCTG
GCCGAAAGCCGCGACGGTCCAGCAATGGTAGCCATCATGCTCGTCACGACGCTGACAGCCGGCCTCGTCATCTGC
CGTCTTCTCGCCCGAACGCTGATGCTCCAACGGTTCGGCGTGGACGACGGCCTGGCCCTGGCCTCGCTCCTCACG
CTGGCCGCCTTCGTCGGTCTAGCCATGGAGCTCATCCAGCTCGGATCGGGAAGACACTACGCCTACATCCAGTAC
GTGCTCCCTCTGTCCACCGTCGAGGCGACGCAGGTGCTCGACTTTGCCGCCCACATCCTCTACACCGTCGCCTTG
CTGCTCTGCCGCGTCTCGGGCCTGGCGTTTTACCACCGCGTGTGCAGCTTGCATCGGGGCTTCCTCGTTGCCATA
CAGGTTGTCTTCGGCTTGTTGATGGCGGGCTTCTTGCCGCAGCTTTTGCTCATCGTCTTTCATTGTCGGCCGGTC
ACGGCGCTTTGGCCGTATGGGTGGGAGCCTTGGAGTGAGGAGTTTGCGTGTTTGCAGTGGGGGGTTGTCTATGTT
ACTAACTCGACGATTTCGTTGACGTGCGATATGCTGCTGTTTGGGATTCCGGTTGCTATGCTGCGGATCCTGGAG
ATGTCGCAGAAGCGCAAGATTCAGCTGGGTTGTATTCTGTTGCCGGGCGTTGCAGTCGTTGCCATCTCCATCACC
CGCCTGGTCCTCGTCGTCATCGGCCAATACATGTCCTGGAGCTACAACGCGCTCCTCACCGTCGAAGTCTCCGAG
ATCGGCGCAACCCTCATCGCCCTATCCGTCCCCGGCGTCAAGCCCATCGTCGACCGCTTCCTCCTCGGCCGGGGC
ACCGTCCTGCACATGGCCACGGCCGGCGGGTCGCGCTACGTGCCCAACAACAAGGCCGGCAGCCTGACCTCGAAG
CACGGGACGGCGCTGAGCACGCTGAAGCTGCGGTCTGATTACAGCGTTCTCGGGGCTGAGACGGCGGCCAACTAT
GGCACTGAGCTCCCCGATCCCGCCCCGACCGCCAGCTTCTCCATCCGACCGGCCCTCTGGCCGTCAGACCTAGAC
GCCGTCCGGGCCTGTTTCGGAGCCTACGTCGAGTGGTTAGGCGAAGATCTCTCCTTTCAAGGCTACGCAGCCGAG
CTGGTCGCCTTGCCCGGCCGATACGCGTCCCCTTCCGGTGCGCTGCTGCTGGCAGTCGGTGACGACGGCGATGGC
GTCCTCCTCGGCTGCATCGCCGGCAGGCCGCTCGGGTCGTCTTCGGTGGGCGCGTGCGAGATGAAGCGACTGTAT
GTCTATCCCGAGGCTCGTGGTTGGGGCGTCTCGCGTGCGTTGGTGAGGAGGCTTGTTTCGTGGGCTGAGAACGAG
GGCTACGAGGAGATGGTGCTGGATACGCTGCCGCGGATGAGTGCTGCCATCGGTCTTTATGCTTCCGAGGGCTTC
GTCGTCACGGAGCCGTACTATCATAATCCTCTTCCCGGGACTCTATACATGGCCAAGAGGCTGGGTCAACACCCC
GGATGA
Gene >Ophun1|3805
ATGGGCGACAGACGGCGCATCAACGAGGCCGTAGCATCAGGACACGTCCCCCCTGACATCAGCGCCGACTTCCTG
GCCGAAAGCCGCGACGGTCCAGCAATGGTAGCCATCATGCTCGTCACGACGCTGACAGCCGGCCTCGTCATCTGC
CGTCTTCTCGCCCGAACGCTGATGCTCCAACGGTTCGGCGTGGACGACGGCCTGGCCCTGGCCTCGCTCCTCACG
CTGGCCGCCTTCGTCGGTCTAGCCATGGAGCTCATCCAGCTCGGATCGGGAAGACACTACGCCTACATCCAGTAC
GTGCTCCCTCTGTCCACCGTCGAGGCGACGCAGGTGCTCGACTTTGCCGCCCACATCCTCTACACCGTCGCCTTG
CTGCTCTGCCGCGTCTCGGGCCTGGCGTTTTACCACCGCGTGTGCAGCTTGCATCGGGGCTTCCTCGTTGCCATA
CAGGTTGTCTTCGGCTTGTTGATGGCGGGCTTCTTGCCGCAGCTTTTGCTCATCGTCTTTCATTGTCGGCCGGTC
ACGGCGCTTTGGCCGTATGGGTGGGAGCCTTGGAGTGAGGAGTTTGCGTGTTTGCAGTGGGGGGTTGTCTATGTT
ACTAACTCGACGATTTCGTTGACGTGCGATATGCTGCTGTTTGGGATTCCGGTTGCTATGCTGCGGATCCTGGAG
ATGTCGCAGAAGCGCAAGATTCAGCTGGGTTGTATTCTGTTGCCGGGCGTTGCGTGAGTTTCAACGAGGGACACG
ATTGCAAAAAGGAAGACGGCTGATGGGGGAAGCCAGAGTCGTTGCCATCTCCATCACCCGCCTGGTCCTCGTCGT
CATCGGCCAATGTAAGTCCAACAGTCCGAGAAGACGACGACCATCTAACCCAGCAAAAAAAAGGGGAAACAGACA
TGTCCTGGAGCTACAACGCGCTCCTCACCGTCGAAGTCTCCGAGATCGGCGCAACCCTCATCGCCCTATCCGTCC
CCGGCGTCAAGCCCATCGTCGACCGCTTCCTCCTCGGCCGGGGCACCGTCCTGCACATGGCCACGGCCGGCGGGT
CGCGCTACGTGCCCAACAACAAGGCCGGCAGCCTGACCTCGAAGCACGGGACGGCGCTGAGCACGCTGAAGCTGC
GGTCTGATTACAGCGTTCTCGGGGCTGAGACGGCGGCCAACTATGGCACTGAGGTCAGTGCTGGCTCGCAGGGGA
ATAATGTTAGTCAGGAGGGGATTCATGTTACGGTTGATTTTCGTGTTAATGATGGTGAGGCGAAGAGGTTTGCTG
CTATGCAGGGGGTATGATTTGTGCATGTCACGACTTGGCCTGCGAACAGCTTCTGGCGTGTTTTTTGTTGACTGC
GTTGTAATGTGCATATTGGATAGACGGTGGCAAGTCGCAGTGCGTGGAGTTGGCGATGCAAATACGAAAACTCTG
AGGAAAGGATCTGTGGCTGGGAAACTAACTCGCAAACCAACCAACCAACTACGCCTTCTATCACCCTCTTTGCAA
GCAAGTTTAAACTCCTTATTTGCGAAGAGCAGGCAGTCAGTTAAAGTCTCAACTTTCTCGCCTAATGCTTCGCAA
AGTCTCGCTCGTCTTACTGCATGTCTGAATTCTGCACTTTGCCGATCGCCCTCGCAATACGGATACGAAAACTCC
TATCCATCAACAACCCTCAACCGCCGAGTCTTTCCTCACCGGACCCCCTTCCCTAGGTTGAGCAAGCTGACTCGA
GTCATTCCTATACAAACATTCAGCCAATGTCAGATGGCCACCGCCCACCGCAGACGAAAACAACAACCAAGCTCC
CCGATCCCGCCCCGACCGCCAGCTTCTCCATCCGACCGGCCCTCTGGCCGTCAGACCTAGACGCCGTCCGGGCCT
GTTTCGGAGCCTACGTCGAGTGGTTAGGCGAAGATCTCTCCTTTCAAGGCTACGCAGCCGAGCTGGTCGCCTTGC
CCGGCCGATACGCGTCCCCTTCCGGTGCGCTGCTGCTGGCAGTCGGTGACGACGGCGATGGCGTCCTCCTCGGCT
GCATCGCCGGCAGGCCGCTCGGGTCGTCTTCGGTGGGCGCGTGCGAGATGAAGCGACTGTATGTCTATCCCGAGG
CTCGTGGTTGGGGCGTCTCGCGTGCGTTGGTGAGGAGGCTTGTTTCGTGGGCTGAGAACGAGGGCTACGAGGAGA
TGGTGCTGGATACGCTGCCGCGGATGAGTGCTGCCATCGGTCTTTATGCTTCCGAGGGCTTCGTCGTCACGGAGC
CGTACTATCATAATCCTCTTCCCGGGACTCTATACATGGCCAAGAGGCTGGGTCAACACCCCGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail