Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3805
Gene name
LocationContig_341:5572..7890
Strand+
Gene length (bp)2318
Transcript length (bp)1581
Coding sequence length (bp)1581
Protein length (aa) 527

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 8.1E-10 410 500
PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain 3.4E-06 425 501
PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain 4.2E-05 445 505

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94340|YHM7_SCHPO Uncharacterized N-acetyltransferase C1271.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.07c PE=3 SV=1 361 517 7.0E-34
sp|Q18B70|ATSE_PEPD6 Acetyltransferase CD1211 OS=Peptoclostridium difficile (strain 630) GN=CD630_12110 PE=3 SV=1 373 521 4.0E-28
sp|Q54GF2|Y0199_DICDI Uncharacterized N-acetyltransferase DDB_G0290199 OS=Dictyostelium discoideum GN=DDB_G0290199 PE=3 SV=1 444 510 8.0E-15
sp|Q8CHQ9|CMLO2_MOUSE Probable N-acetyltransferase CML2 OS=Mus musculus GN=Cml2 PE=1 SV=1 399 507 2.0E-08
sp|P85118|CMLO2_RAT Probable N-acetyltransferase CML2 OS=Rattus norvegicus GN=Cml2 PE=3 SV=1 399 521 7.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94340|YHM7_SCHPO Uncharacterized N-acetyltransferase C1271.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.07c PE=3 SV=1 361 517 7.0E-34
sp|Q18B70|ATSE_PEPD6 Acetyltransferase CD1211 OS=Peptoclostridium difficile (strain 630) GN=CD630_12110 PE=3 SV=1 373 521 4.0E-28
sp|Q54GF2|Y0199_DICDI Uncharacterized N-acetyltransferase DDB_G0290199 OS=Dictyostelium discoideum GN=DDB_G0290199 PE=3 SV=1 444 510 8.0E-15
sp|Q8CHQ9|CMLO2_MOUSE Probable N-acetyltransferase CML2 OS=Mus musculus GN=Cml2 PE=1 SV=1 399 507 2.0E-08
sp|P85118|CMLO2_RAT Probable N-acetyltransferase CML2 OS=Rattus norvegicus GN=Cml2 PE=3 SV=1 399 521 7.0E-07
sp|Q9UHF3|NAT8B_HUMAN Putative N-acetyltransferase 8B OS=Homo sapiens GN=NAT8B PE=5 SV=1 422 508 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008080 N-acetyltransferase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0003674 molecular_function No
GO:0016410 N-acyltransferase activity No
GO:0016407 acetyltransferase activity No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016746 acyltransferase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 32 54 22
2 67 89 22
3 111 133 22
4 146 168 22
5 199 221 22
6 234 256 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup128
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6741
Ophiocordyceps australis 1348a (Ghana) OphauG2|6742
Ophiocordyceps australis map64 (Brazil) OphauB2|1550
Ophiocordyceps camponoti-floridani Ophcf2|01321
Ophiocordyceps camponoti-floridani Ophcf2|06773
Ophiocordyceps camponoti-rufipedis Ophun1|3805 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5428
Ophiocordyceps kimflemingae Ophio5|2627
Ophiocordyceps kimflemingae Ophio5|7426
Ophiocordyceps subramaniannii Hirsu2|10422
Ophiocordyceps subramaniannii Hirsu2|561
Ophiocordyceps subramaniannii Hirsu2|6268
Ophiocordyceps subramaniannii Hirsu2|6488

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3805
MGDRRRINEAVASGHVPPDISADFLAESRDGPAMVAIMLVTTLTAGLVICRLLARTLMLQRFGVDDGLALASLLT
LAAFVGLAMELIQLGSGRHYAYIQYVLPLSTVEATQVLDFAAHILYTVALLLCRVSGLAFYHRVCSLHRGFLVAI
QVVFGLLMAGFLPQLLLIVFHCRPVTALWPYGWEPWSEEFACLQWGVVYVTNSTISLTCDMLLFGIPVAMLRILE
MSQKRKIQLGCILLPGVAVVAISITRLVLVVIGQYMSWSYNALLTVEVSEIGATLIALSVPGVKPIVDRFLLGRG
TVLHMATAGGSRYVPNNKAGSLTSKHGTALSTLKLRSDYSVLGAETAANYGTELPDPAPTASFSIRPALWPSDLD
AVRACFGAYVEWLGEDLSFQGYAAELVALPGRYASPSGALLLAVGDDGDGVLLGCIAGRPLGSSSVGACEMKRLY
VYPEARGWGVSRALVRRLVSWAENEGYEEMVLDTLPRMSAAIGLYASEGFVVTEPYYHNPLPGTLYMAKRLGQHP
G*
Coding >Ophun1|3805
ATGGGCGACAGACGGCGCATCAACGAGGCCGTAGCATCAGGACACGTCCCCCCTGACATCAGCGCCGACTTCCTG
GCCGAAAGCCGCGACGGTCCAGCAATGGTAGCCATCATGCTCGTCACGACGCTGACAGCCGGCCTCGTCATCTGC
CGTCTTCTCGCCCGAACGCTGATGCTCCAACGGTTCGGCGTGGACGACGGCCTGGCCCTGGCCTCGCTCCTCACG
CTGGCCGCCTTCGTCGGTCTAGCCATGGAGCTCATCCAGCTCGGATCGGGAAGACACTACGCCTACATCCAGTAC
GTGCTCCCTCTGTCCACCGTCGAGGCGACGCAGGTGCTCGACTTTGCCGCCCACATCCTCTACACCGTCGCCTTG
CTGCTCTGCCGCGTCTCGGGCCTGGCGTTTTACCACCGCGTGTGCAGCTTGCATCGGGGCTTCCTCGTTGCCATA
CAGGTTGTCTTCGGCTTGTTGATGGCGGGCTTCTTGCCGCAGCTTTTGCTCATCGTCTTTCATTGTCGGCCGGTC
ACGGCGCTTTGGCCGTATGGGTGGGAGCCTTGGAGTGAGGAGTTTGCGTGTTTGCAGTGGGGGGTTGTCTATGTT
ACTAACTCGACGATTTCGTTGACGTGCGATATGCTGCTGTTTGGGATTCCGGTTGCTATGCTGCGGATCCTGGAG
ATGTCGCAGAAGCGCAAGATTCAGCTGGGTTGTATTCTGTTGCCGGGCGTTGCAGTCGTTGCCATCTCCATCACC
CGCCTGGTCCTCGTCGTCATCGGCCAATACATGTCCTGGAGCTACAACGCGCTCCTCACCGTCGAAGTCTCCGAG
ATCGGCGCAACCCTCATCGCCCTATCCGTCCCCGGCGTCAAGCCCATCGTCGACCGCTTCCTCCTCGGCCGGGGC
ACCGTCCTGCACATGGCCACGGCCGGCGGGTCGCGCTACGTGCCCAACAACAAGGCCGGCAGCCTGACCTCGAAG
CACGGGACGGCGCTGAGCACGCTGAAGCTGCGGTCTGATTACAGCGTTCTCGGGGCTGAGACGGCGGCCAACTAT
GGCACTGAGCTCCCCGATCCCGCCCCGACCGCCAGCTTCTCCATCCGACCGGCCCTCTGGCCGTCAGACCTAGAC
GCCGTCCGGGCCTGTTTCGGAGCCTACGTCGAGTGGTTAGGCGAAGATCTCTCCTTTCAAGGCTACGCAGCCGAG
CTGGTCGCCTTGCCCGGCCGATACGCGTCCCCTTCCGGTGCGCTGCTGCTGGCAGTCGGTGACGACGGCGATGGC
GTCCTCCTCGGCTGCATCGCCGGCAGGCCGCTCGGGTCGTCTTCGGTGGGCGCGTGCGAGATGAAGCGACTGTAT
GTCTATCCCGAGGCTCGTGGTTGGGGCGTCTCGCGTGCGTTGGTGAGGAGGCTTGTTTCGTGGGCTGAGAACGAG
GGCTACGAGGAGATGGTGCTGGATACGCTGCCGCGGATGAGTGCTGCCATCGGTCTTTATGCTTCCGAGGGCTTC
GTCGTCACGGAGCCGTACTATCATAATCCTCTTCCCGGGACTCTATACATGGCCAAGAGGCTGGGTCAACACCCC
GGATGA
Transcript >Ophun1|3805
ATGGGCGACAGACGGCGCATCAACGAGGCCGTAGCATCAGGACACGTCCCCCCTGACATCAGCGCCGACTTCCTG
GCCGAAAGCCGCGACGGTCCAGCAATGGTAGCCATCATGCTCGTCACGACGCTGACAGCCGGCCTCGTCATCTGC
CGTCTTCTCGCCCGAACGCTGATGCTCCAACGGTTCGGCGTGGACGACGGCCTGGCCCTGGCCTCGCTCCTCACG
CTGGCCGCCTTCGTCGGTCTAGCCATGGAGCTCATCCAGCTCGGATCGGGAAGACACTACGCCTACATCCAGTAC
GTGCTCCCTCTGTCCACCGTCGAGGCGACGCAGGTGCTCGACTTTGCCGCCCACATCCTCTACACCGTCGCCTTG
CTGCTCTGCCGCGTCTCGGGCCTGGCGTTTTACCACCGCGTGTGCAGCTTGCATCGGGGCTTCCTCGTTGCCATA
CAGGTTGTCTTCGGCTTGTTGATGGCGGGCTTCTTGCCGCAGCTTTTGCTCATCGTCTTTCATTGTCGGCCGGTC
ACGGCGCTTTGGCCGTATGGGTGGGAGCCTTGGAGTGAGGAGTTTGCGTGTTTGCAGTGGGGGGTTGTCTATGTT
ACTAACTCGACGATTTCGTTGACGTGCGATATGCTGCTGTTTGGGATTCCGGTTGCTATGCTGCGGATCCTGGAG
ATGTCGCAGAAGCGCAAGATTCAGCTGGGTTGTATTCTGTTGCCGGGCGTTGCAGTCGTTGCCATCTCCATCACC
CGCCTGGTCCTCGTCGTCATCGGCCAATACATGTCCTGGAGCTACAACGCGCTCCTCACCGTCGAAGTCTCCGAG
ATCGGCGCAACCCTCATCGCCCTATCCGTCCCCGGCGTCAAGCCCATCGTCGACCGCTTCCTCCTCGGCCGGGGC
ACCGTCCTGCACATGGCCACGGCCGGCGGGTCGCGCTACGTGCCCAACAACAAGGCCGGCAGCCTGACCTCGAAG
CACGGGACGGCGCTGAGCACGCTGAAGCTGCGGTCTGATTACAGCGTTCTCGGGGCTGAGACGGCGGCCAACTAT
GGCACTGAGCTCCCCGATCCCGCCCCGACCGCCAGCTTCTCCATCCGACCGGCCCTCTGGCCGTCAGACCTAGAC
GCCGTCCGGGCCTGTTTCGGAGCCTACGTCGAGTGGTTAGGCGAAGATCTCTCCTTTCAAGGCTACGCAGCCGAG
CTGGTCGCCTTGCCCGGCCGATACGCGTCCCCTTCCGGTGCGCTGCTGCTGGCAGTCGGTGACGACGGCGATGGC
GTCCTCCTCGGCTGCATCGCCGGCAGGCCGCTCGGGTCGTCTTCGGTGGGCGCGTGCGAGATGAAGCGACTGTAT
GTCTATCCCGAGGCTCGTGGTTGGGGCGTCTCGCGTGCGTTGGTGAGGAGGCTTGTTTCGTGGGCTGAGAACGAG
GGCTACGAGGAGATGGTGCTGGATACGCTGCCGCGGATGAGTGCTGCCATCGGTCTTTATGCTTCCGAGGGCTTC
GTCGTCACGGAGCCGTACTATCATAATCCTCTTCCCGGGACTCTATACATGGCCAAGAGGCTGGGTCAACACCCC
GGATGA
Gene >Ophun1|3805
ATGGGCGACAGACGGCGCATCAACGAGGCCGTAGCATCAGGACACGTCCCCCCTGACATCAGCGCCGACTTCCTG
GCCGAAAGCCGCGACGGTCCAGCAATGGTAGCCATCATGCTCGTCACGACGCTGACAGCCGGCCTCGTCATCTGC
CGTCTTCTCGCCCGAACGCTGATGCTCCAACGGTTCGGCGTGGACGACGGCCTGGCCCTGGCCTCGCTCCTCACG
CTGGCCGCCTTCGTCGGTCTAGCCATGGAGCTCATCCAGCTCGGATCGGGAAGACACTACGCCTACATCCAGTAC
GTGCTCCCTCTGTCCACCGTCGAGGCGACGCAGGTGCTCGACTTTGCCGCCCACATCCTCTACACCGTCGCCTTG
CTGCTCTGCCGCGTCTCGGGCCTGGCGTTTTACCACCGCGTGTGCAGCTTGCATCGGGGCTTCCTCGTTGCCATA
CAGGTTGTCTTCGGCTTGTTGATGGCGGGCTTCTTGCCGCAGCTTTTGCTCATCGTCTTTCATTGTCGGCCGGTC
ACGGCGCTTTGGCCGTATGGGTGGGAGCCTTGGAGTGAGGAGTTTGCGTGTTTGCAGTGGGGGGTTGTCTATGTT
ACTAACTCGACGATTTCGTTGACGTGCGATATGCTGCTGTTTGGGATTCCGGTTGCTATGCTGCGGATCCTGGAG
ATGTCGCAGAAGCGCAAGATTCAGCTGGGTTGTATTCTGTTGCCGGGCGTTGCGTGAGTTTCAACGAGGGACACG
ATTGCAAAAAGGAAGACGGCTGATGGGGGAAGCCAGAGTCGTTGCCATCTCCATCACCCGCCTGGTCCTCGTCGT
CATCGGCCAATGTAAGTCCAACAGTCCGAGAAGACGACGACCATCTAACCCAGCAAAAAAAAGGGGAAACAGACA
TGTCCTGGAGCTACAACGCGCTCCTCACCGTCGAAGTCTCCGAGATCGGCGCAACCCTCATCGCCCTATCCGTCC
CCGGCGTCAAGCCCATCGTCGACCGCTTCCTCCTCGGCCGGGGCACCGTCCTGCACATGGCCACGGCCGGCGGGT
CGCGCTACGTGCCCAACAACAAGGCCGGCAGCCTGACCTCGAAGCACGGGACGGCGCTGAGCACGCTGAAGCTGC
GGTCTGATTACAGCGTTCTCGGGGCTGAGACGGCGGCCAACTATGGCACTGAGGTCAGTGCTGGCTCGCAGGGGA
ATAATGTTAGTCAGGAGGGGATTCATGTTACGGTTGATTTTCGTGTTAATGATGGTGAGGCGAAGAGGTTTGCTG
CTATGCAGGGGGTATGATTTGTGCATGTCACGACTTGGCCTGCGAACAGCTTCTGGCGTGTTTTTTGTTGACTGC
GTTGTAATGTGCATATTGGATAGACGGTGGCAAGTCGCAGTGCGTGGAGTTGGCGATGCAAATACGAAAACTCTG
AGGAAAGGATCTGTGGCTGGGAAACTAACTCGCAAACCAACCAACCAACTACGCCTTCTATCACCCTCTTTGCAA
GCAAGTTTAAACTCCTTATTTGCGAAGAGCAGGCAGTCAGTTAAAGTCTCAACTTTCTCGCCTAATGCTTCGCAA
AGTCTCGCTCGTCTTACTGCATGTCTGAATTCTGCACTTTGCCGATCGCCCTCGCAATACGGATACGAAAACTCC
TATCCATCAACAACCCTCAACCGCCGAGTCTTTCCTCACCGGACCCCCTTCCCTAGGTTGAGCAAGCTGACTCGA
GTCATTCCTATACAAACATTCAGCCAATGTCAGATGGCCACCGCCCACCGCAGACGAAAACAACAACCAAGCTCC
CCGATCCCGCCCCGACCGCCAGCTTCTCCATCCGACCGGCCCTCTGGCCGTCAGACCTAGACGCCGTCCGGGCCT
GTTTCGGAGCCTACGTCGAGTGGTTAGGCGAAGATCTCTCCTTTCAAGGCTACGCAGCCGAGCTGGTCGCCTTGC
CCGGCCGATACGCGTCCCCTTCCGGTGCGCTGCTGCTGGCAGTCGGTGACGACGGCGATGGCGTCCTCCTCGGCT
GCATCGCCGGCAGGCCGCTCGGGTCGTCTTCGGTGGGCGCGTGCGAGATGAAGCGACTGTATGTCTATCCCGAGG
CTCGTGGTTGGGGCGTCTCGCGTGCGTTGGTGAGGAGGCTTGTTTCGTGGGCTGAGAACGAGGGCTACGAGGAGA
TGGTGCTGGATACGCTGCCGCGGATGAGTGCTGCCATCGGTCTTTATGCTTCCGAGGGCTTCGTCGTCACGGAGC
CGTACTATCATAATCCTCTTCCCGGGACTCTATACATGGCCAAGAGGCTGGGTCAACACCCCGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail