Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3802
Gene name
LocationContig_340:16727..19766
Strand+
Gene length (bp)3039
Transcript length (bp)2883
Coding sequence length (bp)2883
Protein length (aa) 961

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00899 ThiF ThiF family 9.6E-38 32 410
PF00899 ThiF ThiF family 1.1E-70 425 937
PF10585 UBA_E1_SCCH Ubiquitin-activating enzyme, SCCH domain 2.3E-91 614 879
PF16190 E1_FCCH Ubiquitin-activating enzyme E1 FCCH domain 6.0E-28 206 274
PF16191 E1_4HB Ubiquitin-activating enzyme E1 four-helix bundle 4.9E-25 275 342

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P52495|UBA1_CANAW Ubiquitin-activating enzyme E1 1 OS=Candida albicans (strain WO-1) GN=UBA1 PE=3 SV=2 11 957 0.0E+00
sp|O94609|UBA1_SCHPO Ubiquitin-activating enzyme E1 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr3 PE=1 SV=1 11 957 0.0E+00
sp|P22515|UBA1_YEAST Ubiquitin-activating enzyme E1 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBA1 PE=1 SV=2 26 957 0.0E+00
sp|P22314|UBA1_HUMAN Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens GN=UBA1 PE=1 SV=3 26 957 0.0E+00
sp|Q02053|UBA1_MOUSE Ubiquitin-like modifier-activating enzyme 1 OS=Mus musculus GN=Uba1 PE=1 SV=1 26 957 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P52495|UBA1_CANAW Ubiquitin-activating enzyme E1 1 OS=Candida albicans (strain WO-1) GN=UBA1 PE=3 SV=2 11 957 0.0E+00
sp|O94609|UBA1_SCHPO Ubiquitin-activating enzyme E1 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr3 PE=1 SV=1 11 957 0.0E+00
sp|P22515|UBA1_YEAST Ubiquitin-activating enzyme E1 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBA1 PE=1 SV=2 26 957 0.0E+00
sp|P22314|UBA1_HUMAN Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens GN=UBA1 PE=1 SV=3 26 957 0.0E+00
sp|Q02053|UBA1_MOUSE Ubiquitin-like modifier-activating enzyme 1 OS=Mus musculus GN=Uba1 PE=1 SV=1 26 957 0.0E+00
sp|A3KMV5|UBA1_BOVIN Ubiquitin-like modifier-activating enzyme 1 OS=Bos taurus GN=UBA1 PE=2 SV=1 22 957 0.0E+00
sp|Q29504|UBA1_RABIT Ubiquitin-like modifier-activating enzyme 1 OS=Oryctolagus cuniculus GN=UBA1 PE=1 SV=1 26 957 0.0E+00
sp|Q5U300|UBA1_RAT Ubiquitin-like modifier-activating enzyme 1 OS=Rattus norvegicus GN=Uba1 PE=1 SV=1 26 957 0.0E+00
sp|P31254|UBA1Y_MOUSE Ubiquitin-like modifier-activating enzyme 1 Y OS=Mus musculus GN=Uba1y PE=1 SV=2 26 957 0.0E+00
sp|Q55C16|UBA1_DICDI Ubiquitin-like modifier-activating enzyme 1 OS=Dictyostelium discoideum GN=uba1 PE=3 SV=1 26 939 0.0E+00
sp|P92974|UBE12_ARATH Ubiquitin-activating enzyme E1 2 OS=Arabidopsis thaliana GN=UBA2 PE=1 SV=1 26 957 0.0E+00
sp|P93028|UBE11_ARATH Ubiquitin-activating enzyme E1 1 OS=Arabidopsis thaliana GN=UBA1 PE=1 SV=1 26 957 0.0E+00
sp|P31251|UBE12_WHEAT Ubiquitin-activating enzyme E1 2 OS=Triticum aestivum GN=UBA2 PE=2 SV=1 13 957 0.0E+00
sp|P20973|UBE11_WHEAT Ubiquitin-activating enzyme E1 1 OS=Triticum aestivum GN=UBA1 PE=1 SV=1 12 957 0.0E+00
sp|P31252|UBE13_WHEAT Ubiquitin-activating enzyme E1 3 OS=Triticum aestivum GN=UBA3 PE=1 SV=1 26 957 0.0E+00
sp|Q8C7R4|UBA6_MOUSE Ubiquitin-like modifier-activating enzyme 6 OS=Mus musculus GN=Uba6 PE=1 SV=1 24 957 0.0E+00
sp|A0AVT1|UBA6_HUMAN Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens GN=UBA6 PE=1 SV=1 23 957 0.0E+00
sp|P41226|UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7 OS=Homo sapiens GN=UBA7 PE=1 SV=2 27 937 0.0E+00
sp|P31255|UBE1Y_MACRU Ubiquitin-activating enzyme E1 Y (Fragment) OS=Macropus rufus GN=UBE1Y PE=2 SV=1 559 708 2.0E-53
sp|O42939|UBA2_SCHPO Ubiquitin-activating enzyme E1-like OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uba2 PE=1 SV=1 444 755 4.0E-37
sp|Q9SJT1|SAE2_ARATH SUMO-activating enzyme subunit 2 OS=Arabidopsis thaliana GN=SAE2 PE=1 SV=1 437 704 3.0E-36
sp|P52488|UBA2_YEAST Ubiquitin-activating enzyme E1-like OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBA2 PE=1 SV=1 424 633 7.0E-35
sp|Q7SXG4|SAE2_DANRE SUMO-activating enzyme subunit 2 OS=Danio rerio GN=uba2 PE=1 SV=2 435 633 9.0E-32
sp|Q28GH3|SAE2_XENTR SUMO-activating enzyme subunit 2 OS=Xenopus tropicalis GN=uba2 PE=2 SV=1 429 633 4.0E-31
sp|Q9NAN1|SAE2_CAEEL SUMO-activating enzyme subunit uba-2 OS=Caenorhabditis elegans GN=uba-2 PE=3 SV=3 435 633 4.0E-31
sp|Q9V6U8|UBA3_DROME Nedd8-activating enzyme E1 catalytic subunit OS=Drosophila melanogaster GN=Uba3 PE=1 SV=1 446 631 4.0E-31
sp|Q642Q1|SAE2A_XENLA SUMO-activating enzyme subunit 2-A OS=Xenopus laevis GN=uba2-a PE=2 SV=1 429 633 5.0E-31
sp|Q7ZY60|SAE2B_XENLA SUMO-activating enzyme subunit 2-B OS=Xenopus laevis GN=uba2-b PE=2 SV=2 429 633 8.0E-31
sp|Q9UBT2|SAE2_HUMAN SUMO-activating enzyme subunit 2 OS=Homo sapiens GN=UBA2 PE=1 SV=2 435 633 6.0E-30
sp|Q9Z1F9|SAE2_MOUSE SUMO-activating enzyme subunit 2 OS=Mus musculus GN=Uba2 PE=1 SV=1 435 633 7.0E-30
sp|Q8C878|UBA3_MOUSE NEDD8-activating enzyme E1 catalytic subunit OS=Mus musculus GN=Uba3 PE=1 SV=2 444 631 2.0E-27
sp|Q99MI7|UBA3_RAT NEDD8-activating enzyme E1 catalytic subunit OS=Rattus norvegicus GN=Uba3 PE=1 SV=1 444 631 2.0E-27
sp|Q5R4A0|UBA3_PONAB NEDD8-activating enzyme E1 catalytic subunit OS=Pongo abelii GN=UBA3 PE=2 SV=2 444 631 3.0E-27
sp|Q8TBC4|UBA3_HUMAN NEDD8-activating enzyme E1 catalytic subunit OS=Homo sapiens GN=UBA3 PE=1 SV=2 444 631 3.0E-27
sp|Q54L40|SAE2_DICDI SUMO-activating enzyme subunit 2 OS=Dictyostelium discoideum GN=uba2 PE=3 SV=1 424 633 5.0E-27
sp|Q19360|UBA3_CAEEL NEDD8-activating enzyme E1 catalytic subunit OS=Caenorhabditis elegans GN=uba-3 PE=2 SV=2 403 662 1.0E-26
sp|Q7ZVX6|UBA3_DANRE NEDD8-activating enzyme E1 catalytic subunit OS=Danio rerio GN=uba3 PE=2 SV=1 444 631 5.0E-26
sp|Q28DS0|SAE1_XENTR SUMO-activating enzyme subunit 1 OS=Xenopus tropicalis GN=sae1 PE=2 SV=1 15 406 1.0E-25
sp|Q54QG9|UBA3_DICDI NEDD8-activating enzyme E1 catalytic subunit OS=Dictyostelium discoideum GN=uba3 PE=1 SV=1 442 637 3.0E-25
sp|Q5NVN7|SAE1_PONAB SUMO-activating enzyme subunit 1 OS=Pongo abelii GN=SAE1 PE=2 SV=2 23 405 1.0E-24
sp|Q9UBE0|SAE1_HUMAN SUMO-activating enzyme subunit 1 OS=Homo sapiens GN=SAE1 PE=1 SV=1 23 405 1.0E-24
sp|A2VE14|SAE1_BOVIN SUMO-activating enzyme subunit 1 OS=Bos taurus GN=SAE1 PE=2 SV=1 15 405 4.0E-24
sp|O65041|UBA3_ARATH NEDD8-activating enzyme E1 catalytic subunit OS=Arabidopsis thaliana GN=ECR1 PE=1 SV=2 431 630 6.0E-24
sp|Q6AXQ0|SAE1_RAT SUMO-activating enzyme subunit 1 OS=Rattus norvegicus GN=Sae1 PE=2 SV=1 32 405 2.0E-23
sp|Q9R1T2|SAE1_MOUSE SUMO-activating enzyme subunit 1 OS=Mus musculus GN=Sae1 PE=1 SV=1 32 405 3.0E-23
sp|Q99344|UBA3_YEAST NEDD8-activating enzyme E1 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBA3 PE=1 SV=1 442 638 2.0E-22
sp|Q09765|UBA3_SCHPO NEDD8-activating enzyme E1 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uba3 PE=1 SV=1 444 636 2.0E-22
sp|Q8JGT5|SAE1_XENLA SUMO-activating enzyme subunit 1 OS=Xenopus laevis GN=sae1 PE=2 SV=1 15 185 1.0E-21
sp|Q54WI4|SAE1_DICDI SUMO-activating enzyme subunit 1 OS=Dictyostelium discoideum GN=sae1 PE=3 SV=1 23 184 2.0E-18
sp|Q6IQS6|SAE1_DANRE SUMO-activating enzyme subunit 1 OS=Danio rerio GN=sae1 PE=2 SV=1 15 190 7.0E-18
sp|Q06624|RHC31_YEAST DNA damage tolerance protein RHC31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AOS1 PE=1 SV=1 30 198 2.0E-16
sp|P79064|RAD31_SCHPO DNA damage tolerance protein rad31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad31 PE=4 SV=1 30 188 2.0E-15
sp|P0DI13|SA1B2_ARATH SUMO-activating enzyme subunit 1B-2 OS=Arabidopsis thaliana GN=SAE1B-2 PE=1 SV=1 25 182 1.0E-14
sp|P0DI12|SA1B1_ARATH SUMO-activating enzyme subunit 1B-1 OS=Arabidopsis thaliana GN=SAE1B-1 PE=1 SV=1 25 182 1.0E-14
sp|Q9Z1A5|ULA1_RAT NEDD8-activating enzyme E1 regulatory subunit OS=Rattus norvegicus GN=Nae1 PE=1 SV=1 27 176 8.0E-14
sp|Q8VBW6|ULA1_MOUSE NEDD8-activating enzyme E1 regulatory subunit OS=Mus musculus GN=Nae1 PE=1 SV=1 27 176 8.0E-14
sp|Q5ZIE6|ULA1_CHICK NEDD8-activating enzyme E1 regulatory subunit OS=Gallus gallus GN=NAE1 PE=2 SV=1 23 176 1.0E-13
sp|O59954|UBA4_EMENI Adenylyltransferase and sulfurtransferase uba4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uba4 PE=1 SV=2 424 586 2.0E-13
sp|Q13564|ULA1_HUMAN NEDD8-activating enzyme E1 regulatory subunit OS=Homo sapiens GN=NAE1 PE=1 SV=1 27 176 7.0E-13
sp|B0W377|MOCS3_CULQU Adenylyltransferase and sulfurtransferase MOCS3 OS=Culex quinquefasciatus GN=CPIJ001621 PE=3 SV=1 423 585 8.0E-13
sp|B4NXF7|MOCS3_DROYA Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila yakuba GN=GE18783 PE=3 SV=1 423 585 1.0E-12
sp|A2R3H4|UBA4_ASPNC Adenylyltransferase and sulfurtransferase uba4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=uba4 PE=3 SV=1 424 586 4.0E-12
sp|Q18217|ULA1_CAEEL NEDD8-activating enzyme E1 regulatory subunit OS=Caenorhabditis elegans GN=ula-1 PE=3 SV=2 32 196 5.0E-12
sp|Q2TWN3|UBA4_ASPOR Adenylyltransferase and sulfurtransferase uba4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=uba4 PE=3 SV=1 437 586 5.0E-12
sp|Q0CFD4|UBA4_ASPTN Adenylyltransferase and sulfurtransferase uba4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=uba4 PE=3 SV=1 412 586 8.0E-12
sp|Q17CA7|MOCS3_AEDAE Adenylyltransferase and sulfurtransferase MOCS3 OS=Aedes aegypti GN=AAEL004607 PE=3 SV=1 423 585 1.0E-11
sp|B3MLX7|MOCS3_DROAN Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila ananassae GN=GF15533 PE=3 SV=1 423 585 1.0E-11
sp|Q7PY41|MOCS3_ANOGA Adenylyltransferase and sulfurtransferase MOCS3 OS=Anopheles gambiae GN=AGAP001737 PE=3 SV=4 423 585 2.0E-11
sp|Q54JM3|ULA1_DICDI NEDD8-activating enzyme E1 regulatory subunit OS=Dictyostelium discoideum GN=nae1 PE=3 SV=1 22 178 2.0E-11
sp|A1CAZ7|UBA4_ASPCL Adenylyltransferase and sulfurtransferase uba4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=uba4 PE=3 SV=1 424 586 3.0E-11
sp|B4N7R4|MOCS3_DROWI Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila willistoni GN=GK18675 PE=3 SV=1 423 585 3.0E-11
sp|B4HYP0|MOCS3_DROSE Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila sechellia GN=GM17034 PE=3 SV=1 423 585 3.0E-11
sp|Q8VY78|SAE1A_ARATH SUMO-activating enzyme subunit 1A OS=Arabidopsis thaliana GN=SAE1A PE=1 SV=1 25 182 3.0E-11
sp|P38820|UBA4_YEAST Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBA4 PE=1 SV=1 409 586 4.0E-11
sp|B5VK45|UBA4_YEAS6 Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=UBA4 PE=3 SV=1 409 586 4.0E-11
sp|B3LSM6|UBA4_YEAS1 Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=UBA4 PE=3 SV=1 409 586 4.0E-11
sp|P45211|MOEB_HAEIN Molybdopterin-synthase adenylyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=moeB PE=3 SV=1 424 585 4.0E-11
sp|Q4WV19|UBA4_ASPFU Adenylyltransferase and sulfurtransferase uba4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=uba4 PE=3 SV=1 424 586 5.0E-11
sp|B4JBC4|MOCS3_DROGR Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila grimshawi GN=GH10959 PE=3 SV=1 408 585 5.0E-11
sp|Q8AWD2|MOCS3_DANRE Adenylyltransferase and sulfurtransferase MOCS3 OS=Danio rerio GN=mocs3 PE=2 SV=1 424 585 5.0E-11
sp|A6ZT19|UBA4_YEAS7 Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain YJM789) GN=UBA4 PE=3 SV=1 409 586 8.0E-11
sp|A4RPM5|UBA4_MAGO7 Adenylyltransferase and sulfurtransferase uba4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=UBA4 PE=3 SV=1 424 586 8.0E-11
sp|Q6CMC2|UBA4_KLULA Adenylyltransferase and sulfurtransferase UBA4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=UBA4 PE=3 SV=1 424 585 9.0E-11
sp|Q7SXP2|ULA1_DANRE NEDD8-activating enzyme E1 regulatory subunit OS=Danio rerio GN=nae1 PE=2 SV=2 29 176 1.0E-10
sp|Q58E95|MOCS3_XENLA Adenylyltransferase and sulfurtransferase MOCS3 OS=Xenopus laevis GN=mocs3 PE=2 SV=1 405 609 1.0E-10
sp|B4LRB9|MOCS3_DROVI Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila virilis GN=GJ21670 PE=3 SV=1 423 585 1.0E-10
sp|A8WRE3|MOCS3_CAEBR Adenylyltransferase and sulfurtransferase MOCS3 OS=Caenorhabditis briggsae GN=uba-4 PE=3 SV=3 409 585 2.0E-10
sp|B4FAT0|MOC32_MAIZE Adenylyltransferase and sulfurtransferase MOCS3-2 OS=Zea mays GN=MOCS3-2 PE=2 SV=1 432 585 2.0E-10
sp|O44510|MOCS3_CAEEL Adenylyltransferase and sulfurtransferase MOCS3 OS=Caenorhabditis elegans GN=moc-3 PE=3 SV=2 424 585 2.0E-10
sp|Q7SXG4|SAE2_DANRE SUMO-activating enzyme subunit 2 OS=Danio rerio GN=uba2 PE=1 SV=2 847 923 3.0E-10
sp|A7THV5|UBA4_VANPO Adenylyltransferase and sulfurtransferase UBA4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=UBA4 PE=3 SV=1 424 586 3.0E-10
sp|A5DMB6|UBA4_PICGU Adenylyltransferase and sulfurtransferase UBA4 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=UBA4 PE=3 SV=1 424 585 3.0E-10
sp|Q9VLJ8|MOCS3_DROME Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila melanogaster GN=CG13090 PE=1 SV=1 423 585 3.0E-10
sp|B0Y0P7|UBA4_ASPFC Adenylyltransferase and sulfurtransferase uba4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=uba4 PE=3 SV=1 424 586 3.0E-10
sp|Q6NTW6|ULA1_XENLA NEDD8-activating enzyme E1 regulatory subunit OS=Xenopus laevis GN=nae1 PE=2 SV=1 24 200 3.0E-10
sp|P42744|ULA1_ARATH NEDD8-activating enzyme E1 regulatory subunit OS=Arabidopsis thaliana GN=AXR1 PE=1 SV=1 32 176 4.0E-10
sp|B6TNK6|MOC31_MAIZE Adenylyltransferase and sulfurtransferase MOCS3-1 OS=Zea mays GN=MOCS3-1 PE=2 SV=1 432 585 7.0E-10
sp|Q28GH3|SAE2_XENTR SUMO-activating enzyme subunit 2 OS=Xenopus tropicalis GN=uba2 PE=2 SV=1 843 923 1.0E-09
sp|Q4R3L6|ULA1_MACFA NEDD8-activating enzyme E1 regulatory subunit OS=Macaca fascicularis GN=NAE1 PE=2 SV=1 27 176 1.0E-09
sp|A1DED8|UBA4_NEOFI Adenylyltransferase and sulfurtransferase uba4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=uba4 PE=3 SV=1 413 586 1.0E-09
sp|B5DS72|MOC31_DROPS Adenylyltransferase and sulfurtransferase MOCS3-1 OS=Drosophila pseudoobscura pseudoobscura GN=GA24966 PE=3 SV=1 423 585 1.0E-09
sp|Q9UBT2|SAE2_HUMAN SUMO-activating enzyme subunit 2 OS=Homo sapiens GN=UBA2 PE=1 SV=2 844 923 2.0E-09
sp|B4GKQ3|MOCS3_DROPE Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila persimilis GN=GL26133 PE=3 SV=1 423 585 2.0E-09
sp|Q29PG5|MOC32_DROPS Adenylyltransferase and sulfurtransferase MOCS3-2 OS=Drosophila pseudoobscura pseudoobscura GN=GA12041 PE=3 SV=1 423 585 2.0E-09
sp|A5GFZ6|MOCS3_PIG Adenylyltransferase and sulfurtransferase MOCS3 OS=Sus scrofa GN=MOCS3 PE=3 SV=1 424 585 2.0E-09
sp|O23034|UBA5_ARATH Ubiquitin-like modifier-activating enzyme 5 OS=Arabidopsis thaliana GN=At1g05350 PE=3 SV=2 449 601 2.0E-09
sp|O44510|MOCS3_CAEEL Adenylyltransferase and sulfurtransferase MOCS3 OS=Caenorhabditis elegans GN=moc-3 PE=3 SV=2 15 159 3.0E-09
sp|Q642Q1|SAE2A_XENLA SUMO-activating enzyme subunit 2-A OS=Xenopus laevis GN=uba2-a PE=2 SV=1 843 923 4.0E-09
sp|Q7ZY60|SAE2B_XENLA SUMO-activating enzyme subunit 2-B OS=Xenopus laevis GN=uba2-b PE=2 SV=2 843 923 4.0E-09
sp|Q9Z1F9|SAE2_MOUSE SUMO-activating enzyme subunit 2 OS=Mus musculus GN=Uba2 PE=1 SV=1 847 923 4.0E-09
sp|A3LQF9|UBA4_PICST Adenylyltransferase and sulfurtransferase UBA4 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=UBA4 PE=3 SV=2 412 586 5.0E-09
sp|A1A4L8|MOCS3_BOVIN Adenylyltransferase and sulfurtransferase MOCS3 OS=Bos taurus GN=MOCS3 PE=2 SV=2 402 585 7.0E-09
sp|O95396|MOCS3_HUMAN Adenylyltransferase and sulfurtransferase MOCS3 OS=Homo sapiens GN=MOCS3 PE=1 SV=1 424 585 7.0E-09
sp|P30138|THIF_ECOLI Sulfur carrier protein ThiS adenylyltransferase OS=Escherichia coli (strain K12) GN=thiF PE=1 SV=2 424 588 8.0E-09
sp|Q54L40|SAE2_DICDI SUMO-activating enzyme subunit 2 OS=Dictyostelium discoideum GN=uba2 PE=3 SV=1 840 913 1.0E-08
sp|P30138|THIF_ECOLI Sulfur carrier protein ThiS adenylyltransferase OS=Escherichia coli (strain K12) GN=thiF PE=1 SV=2 32 116 1.0E-08
sp|Q9ZNW0|MOCS3_ARATH Adenylyltransferase and sulfurtransferase MOCS3 OS=Arabidopsis thaliana GN=MOCS3 PE=2 SV=1 424 585 1.0E-08
sp|Q54C02|UBA5_DICDI Ubiquitin-like modifier-activating enzyme 5 OS=Dictyostelium discoideum GN=uba5 PE=3 SV=1 438 588 2.0E-08
sp|Q756K6|UBA4_ASHGO Adenylyltransferase and sulfurtransferase UBA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=UBA4 PE=3 SV=1 424 585 2.0E-08
sp|Q19360|UBA3_CAEEL NEDD8-activating enzyme E1 catalytic subunit OS=Caenorhabditis elegans GN=uba-3 PE=2 SV=2 29 143 4.0E-08
sp|O65041|UBA3_ARATH NEDD8-activating enzyme E1 catalytic subunit OS=Arabidopsis thaliana GN=ECR1 PE=1 SV=2 52 155 4.0E-08
sp|Q6K6K7|UBA5_ORYSJ Ubiquitin-like modifier-activating enzyme 5 OS=Oryza sativa subsp. japonica GN=Os02g0506500 PE=2 SV=1 449 601 4.0E-08
sp|P12282|MOEB_ECOLI Molybdopterin-synthase adenylyltransferase OS=Escherichia coli (strain K12) GN=moeB PE=1 SV=1 415 585 4.0E-08
sp|B4KI53|MOCS3_DROMO Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila mojavensis GN=GI10453 PE=3 SV=1 423 585 5.0E-08
sp|O42939|UBA2_SCHPO Ubiquitin-activating enzyme E1-like OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uba2 PE=1 SV=1 842 922 7.0E-08
sp|Q55FS0|UBA4_DICDI Adenylyltransferase and sulfurtransferase MOCS3 OS=Dictyostelium discoideum GN=mocs3 PE=3 SV=1 424 581 7.0E-08
sp|Q9VTE9|ULA1_DROME Nedd8-activating enzyme E1 regulatory subunit OS=Drosophila melanogaster GN=APP-BP1 PE=1 SV=1 412 670 8.0E-08
sp|Q09810|UBA4_SCHPO Adenylyltransferase and sulfurtransferase uba4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uba4 PE=3 SV=1 412 581 9.0E-08
sp|Q17820|SAE1_CAEEL SUMO-activating enzyme subunit aos-1 OS=Caenorhabditis elegans GN=aos-1 PE=3 SV=1 24 230 1.0E-07
sp|Q59WH7|UBA4_CANAL Adenylyltransferase and sulfurtransferase UBA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UBA4 PE=3 SV=1 424 586 1.0E-07
sp|P9WMN7|MOEZ_MYCTU Probable adenylyltransferase/sulfurtransferase MoeZ OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=moeZ PE=1 SV=1 406 585 1.0E-07
sp|P9WMN6|MOEZ_MYCTO Probable adenylyltransferase/sulfurtransferase MoeZ OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=moeZ PE=3 SV=1 406 585 1.0E-07
sp|Q9SJT1|SAE2_ARATH SUMO-activating enzyme subunit 2 OS=Arabidopsis thaliana GN=SAE2 PE=1 SV=1 844 918 2.0E-07
sp|Q9VTE9|ULA1_DROME Nedd8-activating enzyme E1 regulatory subunit OS=Drosophila melanogaster GN=APP-BP1 PE=1 SV=1 32 188 2.0E-07
sp|Q6CBK1|UBA4_YARLI Adenylyltransferase and sulfurtransferase UBA4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=UBA4 PE=3 SV=1 424 585 2.0E-07
sp|A2BDX3|MOCS3_MOUSE Adenylyltransferase and sulfurtransferase MOCS3 OS=Mus musculus GN=Mocs3 PE=1 SV=1 424 585 2.0E-07
sp|Q57097|TCDA_HAEIN tRNA threonylcarbamoyladenosine dehydratase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=tcdA PE=3 SV=1 438 600 2.0E-07
sp|Q6BHZ2|UBA4_DEBHA Adenylyltransferase and sulfurtransferase UBA4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=UBA4 PE=3 SV=1 424 589 2.0E-07
sp|A5DSR2|UBA4_LODEL Adenylyltransferase and sulfurtransferase UBA4 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=UBA4 PE=3 SV=1 383 586 3.0E-07
sp|P22515|UBA1_YEAST Ubiquitin-activating enzyme E1 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBA1 PE=1 SV=2 24 116 4.0E-07
sp|Q54QG9|UBA3_DICDI NEDD8-activating enzyme E1 catalytic subunit OS=Dictyostelium discoideum GN=uba3 PE=1 SV=1 52 143 4.0E-07
sp|Q9NAN1|SAE2_CAEEL SUMO-activating enzyme subunit uba-2 OS=Caenorhabditis elegans GN=uba-2 PE=3 SV=3 849 910 6.0E-07
sp|A8WRE3|MOCS3_CAEBR Adenylyltransferase and sulfurtransferase MOCS3 OS=Caenorhabditis briggsae GN=uba-4 PE=3 SV=3 15 159 6.0E-07
sp|Q7ZVX6|UBA3_DANRE NEDD8-activating enzyme E1 catalytic subunit OS=Danio rerio GN=uba3 PE=2 SV=1 47 143 7.0E-07
sp|Q9UT93|ULA1_SCHPO NEDD8-activating enzyme E1 regulatory subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uba5 PE=3 SV=2 419 602 8.0E-07
sp|Q8C878|UBA3_MOUSE NEDD8-activating enzyme E1 catalytic subunit OS=Mus musculus GN=Uba3 PE=1 SV=2 47 143 1.0E-06
sp|Q99MI7|UBA3_RAT NEDD8-activating enzyme E1 catalytic subunit OS=Rattus norvegicus GN=Uba3 PE=1 SV=1 47 143 1.0E-06
sp|Q9Z1F9|SAE2_MOUSE SUMO-activating enzyme subunit 2 OS=Mus musculus GN=Uba2 PE=1 SV=1 39 178 2.0E-06
sp|Q5R4A0|UBA3_PONAB NEDD8-activating enzyme E1 catalytic subunit OS=Pongo abelii GN=UBA3 PE=2 SV=2 47 143 2.0E-06
sp|Q8TBC4|UBA3_HUMAN NEDD8-activating enzyme E1 catalytic subunit OS=Homo sapiens GN=UBA3 PE=1 SV=2 47 143 2.0E-06
sp|Q06624|RHC31_YEAST DNA damage tolerance protein RHC31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AOS1 PE=1 SV=1 425 578 2.0E-06
sp|Q54L40|SAE2_DICDI SUMO-activating enzyme subunit 2 OS=Dictyostelium discoideum GN=uba2 PE=3 SV=1 32 178 3.0E-06
sp|Q18217|ULA1_CAEEL NEDD8-activating enzyme E1 regulatory subunit OS=Caenorhabditis elegans GN=ula-1 PE=3 SV=2 422 600 3.0E-06
sp|Q6FR35|UBA4_CANGA Adenylyltransferase and sulfurtransferase UBA4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=UBA4 PE=3 SV=1 423 586 3.0E-06
sp|Q46927|TCDA_ECOLI tRNA threonylcarbamoyladenosine dehydratase OS=Escherichia coli (strain K12) GN=tcdA PE=1 SV=1 424 600 4.0E-06
sp|Q8VY78|SAE1A_ARATH SUMO-activating enzyme subunit 1A OS=Arabidopsis thaliana GN=SAE1A PE=1 SV=1 279 402 6.0E-06
sp|Q09765|UBA3_SCHPO NEDD8-activating enzyme E1 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uba3 PE=1 SV=1 41 112 7.0E-06
sp|Q7ZY60|SAE2B_XENLA SUMO-activating enzyme subunit 2-B OS=Xenopus laevis GN=uba2-b PE=2 SV=2 39 178 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3802
MAGQKLPEVDLTTRMQVDESIIGTTEIDESLYSRQLYVLGHEAMKRMGASNVLIVGLRGLGVEIAKNIALAGVKS
LTLYDPAPVQLADLSAQFFLTPSDVGKPRDQVTAPRVAELNAYTPIKLHQSSGLDADPSQFDKYQVVVLTNLLIS
SQKAIGDYCHSKGIYVVIVNTFGLFGSIFCDFGENFTVIDPTGETPLSGIVAGIDEDGTVSALDEVRHDLEDGDY
VTFSELEGMEGLNGCEPRKISVKGPYTFSIGDVSGLGTYKRGGMYQQVKMPKPVNFKSFTASLKEPEFLVSDFAK
FDRPQQLHLGFQALEAFQVAKGRLPKPMNEEDAAVMLGAVKKFAQEQSLDLELNEKLLKELSFQATGDLSAMAAF
FGGIAAQEVLKAVSGKFQPICQWMYFDSLESLPESTPRTAELCAPRGSRYDGQIAVFGAEFQDKIANLKQFLVGA
GAIGCEMLKNWAMMGLGTGPRGQIYVTDMDSIEKSNLNRQFLFRAADVGSMKSDCAARAVQRMNPDLEGHMVTMK
DRVSADTEHTFDETFWQGLDGVTNALDNVEARTYVDRRCVFFRKPLLESGTLGTKGNTQVVLPHLTESYSSSQDP
PEKEFPMCTIRSFPNRIEHTIAWAKEYMFEKSFVKAPQTVNLYLTQPKFLETAMKQGGNQKETMETIRNYLTTER
PRTFEDCIAWARMLFETEFSNKIQQLLYNFPKDSVTSSGTPFWSGPKRAPDPLKFDANNPTHFGFIVAAANLHAF
NFNIKSPGMDRSVYVRELDNVIVPDFAPDANVKIQADDKEPVSEISVVSVAPEVLMINFKDPTSFDDTDEVRKIM
ASIPSPSSLAGFQLQPVEFEKDDDSNHHIDFITACSNLRAENYKIEAADRHKTKFIAGKIIPAIATTTALVTGLV
VLELFKIIDGKQDLEQYKNGFINLALPFFGFSEPIQSPKVEYQGPDGKVTLDKIWDRPRG*
Coding >Ophun1|3802
ATGGCGGGCCAGAAGCTCCCAGAGGTCGACCTGACGACGCGAATGCAGGTCGACGAGTCCATCATCGGCACCACC
GAGATCGACGAGTCCCTCTACAGCCGTCAGCTCTATGTCCTGGGTCACGAGGCCATGAAGCGCATGGGCGCCTCC
AACGTGCTCATCGTCGGTCTGAGGGGCCTCGGCGTCGAGATCGCAAAGAACATCGCCCTGGCTGGCGTCAAGAGT
CTTACGCTCTACGATCCTGCTCCTGTTCAGCTGGCCGATCTGTCCGCCCAGTTCTTCCTCACCCCGTCCGACGTT
GGCAAGCCCAGGGATCAGGTGACGGCGCCGCGCGTGGCCGAGCTCAACGCCTACACTCCCATCAAGCTGCACCAG
TCATCCGGACTGGACGCGGATCCTAGCCAGTTCGACAAGTATCAAGTCGTCGTCCTCACCAACCTGCTCATCTCG
TCCCAGAAAGCCATTGGAGACTACTGTCATTCCAAGGGCATCTACGTCGTCATCGTCAACACCTTCGGCCTGTTT
GGCTCCATATTCTGTGACTTTGGAGAAAATTTCACCGTCATCGACCCGACGGGCGAGACGCCTCTGAGCGGAATA
GTCGCCGGCATCGACGAGGACGGCACCGTATCGGCCCTCGACGAGGTGCGCCACGACTTGGAGGATGGCGACTAC
GTCACCTTTTCCGAGTTGGAGGGCATGGAAGGCCTCAACGGGTGCGAGCCTCGCAAAATCAGCGTCAAAGGGCCC
TACACCTTTTCCATCGGCGACGTGTCGGGCCTCGGCACCTACAAGCGTGGCGGAATGTATCAGCAGGTCAAGATG
CCTAAGCCCGTCAACTTCAAGAGCTTCACGGCCTCTCTCAAGGAGCCCGAGTTCCTCGTGTCCGACTTTGCCAAG
TTCGACCGGCCTCAGCAGCTGCACCTCGGATTCCAGGCCCTGGAGGCCTTTCAGGTGGCCAAGGGACGACTGCCG
AAGCCCATGAACGAGGAAGACGCCGCGGTGATGCTGGGCGCCGTCAAGAAGTTTGCCCAGGAGCAGTCGCTCGAC
CTGGAACTGAACGAGAAGCTGCTGAAAGAGCTCAGCTTCCAGGCCACGGGTGATCTCAGCGCCATGGCGGCCTTT
TTCGGTGGCATCGCGGCGCAAGAGGTGCTCAAGGCCGTCTCGGGCAAGTTCCAGCCCATCTGCCAGTGGATGTAC
TTTGACTCGCTCGAGTCGCTGCCCGAGTCGACGCCCCGGACGGCCGAGCTGTGCGCGCCCCGGGGAAGCCGCTAC
GATGGTCAGATTGCCGTCTTCGGCGCCGAGTTCCAGGATAAGATTGCCAACTTGAAGCAGTTCCTGGTGGGCGCG
GGCGCCATCGGGTGCGAGATGCTCAAGAACTGGGCCATGATGGGTCTCGGTACCGGTCCCAGGGGCCAGATTTAC
GTGACGGACATGGACTCGATCGAAAAGAGCAACCTGAACCGCCAGTTCCTGTTCCGAGCCGCCGACGTGGGCAGC
ATGAAGAGCGACTGCGCGGCGCGGGCCGTTCAGCGCATGAACCCAGACCTTGAGGGCCATATGGTGACGATGAAG
GACCGGGTCAGCGCTGACACGGAGCACACGTTTGACGAAACGTTCTGGCAGGGGCTGGACGGAGTGACGAACGCG
CTGGACAACGTCGAGGCTCGGACCTACGTCGACCGGCGCTGCGTCTTCTTCCGCAAGCCCCTGCTGGAGAGCGGC
ACGCTGGGCACCAAGGGCAACACGCAGGTGGTTCTCCCGCACCTGACGGAGTCGTACTCGTCGTCGCAGGATCCG
CCGGAGAAGGAGTTTCCCATGTGCACGATCCGCAGCTTTCCGAACCGAATCGAGCATACGATTGCGTGGGCCAAG
GAGTACATGTTTGAAAAGTCGTTTGTTAAGGCGCCGCAGACGGTGAACCTATACCTGACGCAGCCCAAGTTCCTC
GAGACGGCCATGAAGCAGGGCGGCAACCAGAAGGAGACGATGGAGACGATCCGAAACTACCTGACGACGGAGCGA
CCACGAACATTCGAGGACTGCATTGCCTGGGCGCGGATGCTGTTCGAGACGGAGTTCTCCAACAAGATCCAGCAG
CTGCTGTACAACTTTCCCAAGGACTCGGTGACGTCGAGCGGCACGCCCTTTTGGTCAGGGCCGAAGCGAGCTCCG
GATCCGCTCAAGTTTGACGCCAACAACCCGACGCACTTTGGCTTCATCGTGGCGGCGGCCAACCTGCACGCCTTC
AACTTCAACATCAAGTCTCCGGGCATGGACAGGTCCGTCTACGTGAGGGAGCTGGACAATGTCATTGTGCCCGAC
TTTGCACCGGATGCCAATGTCAAGATTCAGGCTGATGACAAGGAGCCGGTGAGCGAGATCAGTGTGGTTTCTGTT
GCTCCCGAGGTGCTGATGATAAATTTCAAGGATCCCACTTCGTTTGACGATACGGACGAGGTTCGCAAAATCATG
GCGAGCATCCCGTCGCCCAGCTCGCTGGCGGGCTTCCAGCTGCAGCCTGTCGAGTTCGAGAAGGACGACGACTCG
AATCACCACATCGACTTCATTACGGCGTGCAGCAACCTGCGGGCGGAGAACTACAAGATTGAGGCAGCGGACCGG
CACAAGACCAAGTTTATCGCGGGCAAGATTATCCCGGCCATCGCGACGACGACAGCGCTGGTGACGGGCCTCGTG
GTGCTGGAGCTGTTCAAGATTATAGACGGCAAGCAGGATCTCGAGCAGTACAAGAACGGCTTCATCAACCTGGCG
CTTCCCTTTTTCGGCTTCAGCGAGCCCATCCAGAGCCCCAAGGTGGAGTACCAAGGCCCGGACGGCAAGGTGACG
CTGGACAAGATCTGGGACCGGCCAAGGGGCTGA
Transcript >Ophun1|3802
ATGGCGGGCCAGAAGCTCCCAGAGGTCGACCTGACGACGCGAATGCAGGTCGACGAGTCCATCATCGGCACCACC
GAGATCGACGAGTCCCTCTACAGCCGTCAGCTCTATGTCCTGGGTCACGAGGCCATGAAGCGCATGGGCGCCTCC
AACGTGCTCATCGTCGGTCTGAGGGGCCTCGGCGTCGAGATCGCAAAGAACATCGCCCTGGCTGGCGTCAAGAGT
CTTACGCTCTACGATCCTGCTCCTGTTCAGCTGGCCGATCTGTCCGCCCAGTTCTTCCTCACCCCGTCCGACGTT
GGCAAGCCCAGGGATCAGGTGACGGCGCCGCGCGTGGCCGAGCTCAACGCCTACACTCCCATCAAGCTGCACCAG
TCATCCGGACTGGACGCGGATCCTAGCCAGTTCGACAAGTATCAAGTCGTCGTCCTCACCAACCTGCTCATCTCG
TCCCAGAAAGCCATTGGAGACTACTGTCATTCCAAGGGCATCTACGTCGTCATCGTCAACACCTTCGGCCTGTTT
GGCTCCATATTCTGTGACTTTGGAGAAAATTTCACCGTCATCGACCCGACGGGCGAGACGCCTCTGAGCGGAATA
GTCGCCGGCATCGACGAGGACGGCACCGTATCGGCCCTCGACGAGGTGCGCCACGACTTGGAGGATGGCGACTAC
GTCACCTTTTCCGAGTTGGAGGGCATGGAAGGCCTCAACGGGTGCGAGCCTCGCAAAATCAGCGTCAAAGGGCCC
TACACCTTTTCCATCGGCGACGTGTCGGGCCTCGGCACCTACAAGCGTGGCGGAATGTATCAGCAGGTCAAGATG
CCTAAGCCCGTCAACTTCAAGAGCTTCACGGCCTCTCTCAAGGAGCCCGAGTTCCTCGTGTCCGACTTTGCCAAG
TTCGACCGGCCTCAGCAGCTGCACCTCGGATTCCAGGCCCTGGAGGCCTTTCAGGTGGCCAAGGGACGACTGCCG
AAGCCCATGAACGAGGAAGACGCCGCGGTGATGCTGGGCGCCGTCAAGAAGTTTGCCCAGGAGCAGTCGCTCGAC
CTGGAACTGAACGAGAAGCTGCTGAAAGAGCTCAGCTTCCAGGCCACGGGTGATCTCAGCGCCATGGCGGCCTTT
TTCGGTGGCATCGCGGCGCAAGAGGTGCTCAAGGCCGTCTCGGGCAAGTTCCAGCCCATCTGCCAGTGGATGTAC
TTTGACTCGCTCGAGTCGCTGCCCGAGTCGACGCCCCGGACGGCCGAGCTGTGCGCGCCCCGGGGAAGCCGCTAC
GATGGTCAGATTGCCGTCTTCGGCGCCGAGTTCCAGGATAAGATTGCCAACTTGAAGCAGTTCCTGGTGGGCGCG
GGCGCCATCGGGTGCGAGATGCTCAAGAACTGGGCCATGATGGGTCTCGGTACCGGTCCCAGGGGCCAGATTTAC
GTGACGGACATGGACTCGATCGAAAAGAGCAACCTGAACCGCCAGTTCCTGTTCCGAGCCGCCGACGTGGGCAGC
ATGAAGAGCGACTGCGCGGCGCGGGCCGTTCAGCGCATGAACCCAGACCTTGAGGGCCATATGGTGACGATGAAG
GACCGGGTCAGCGCTGACACGGAGCACACGTTTGACGAAACGTTCTGGCAGGGGCTGGACGGAGTGACGAACGCG
CTGGACAACGTCGAGGCTCGGACCTACGTCGACCGGCGCTGCGTCTTCTTCCGCAAGCCCCTGCTGGAGAGCGGC
ACGCTGGGCACCAAGGGCAACACGCAGGTGGTTCTCCCGCACCTGACGGAGTCGTACTCGTCGTCGCAGGATCCG
CCGGAGAAGGAGTTTCCCATGTGCACGATCCGCAGCTTTCCGAACCGAATCGAGCATACGATTGCGTGGGCCAAG
GAGTACATGTTTGAAAAGTCGTTTGTTAAGGCGCCGCAGACGGTGAACCTATACCTGACGCAGCCCAAGTTCCTC
GAGACGGCCATGAAGCAGGGCGGCAACCAGAAGGAGACGATGGAGACGATCCGAAACTACCTGACGACGGAGCGA
CCACGAACATTCGAGGACTGCATTGCCTGGGCGCGGATGCTGTTCGAGACGGAGTTCTCCAACAAGATCCAGCAG
CTGCTGTACAACTTTCCCAAGGACTCGGTGACGTCGAGCGGCACGCCCTTTTGGTCAGGGCCGAAGCGAGCTCCG
GATCCGCTCAAGTTTGACGCCAACAACCCGACGCACTTTGGCTTCATCGTGGCGGCGGCCAACCTGCACGCCTTC
AACTTCAACATCAAGTCTCCGGGCATGGACAGGTCCGTCTACGTGAGGGAGCTGGACAATGTCATTGTGCCCGAC
TTTGCACCGGATGCCAATGTCAAGATTCAGGCTGATGACAAGGAGCCGGTGAGCGAGATCAGTGTGGTTTCTGTT
GCTCCCGAGGTGCTGATGATAAATTTCAAGGATCCCACTTCGTTTGACGATACGGACGAGGTTCGCAAAATCATG
GCGAGCATCCCGTCGCCCAGCTCGCTGGCGGGCTTCCAGCTGCAGCCTGTCGAGTTCGAGAAGGACGACGACTCG
AATCACCACATCGACTTCATTACGGCGTGCAGCAACCTGCGGGCGGAGAACTACAAGATTGAGGCAGCGGACCGG
CACAAGACCAAGTTTATCGCGGGCAAGATTATCCCGGCCATCGCGACGACGACAGCGCTGGTGACGGGCCTCGTG
GTGCTGGAGCTGTTCAAGATTATAGACGGCAAGCAGGATCTCGAGCAGTACAAGAACGGCTTCATCAACCTGGCG
CTTCCCTTTTTCGGCTTCAGCGAGCCCATCCAGAGCCCCAAGGTGGAGTACCAAGGCCCGGACGGCAAGGTGACG
CTGGACAAGATCTGGGACCGGCCAAGGGGCTGA
Gene >Ophun1|3802
ATGGCGGTGAGTCTCCCGCGAAAGGCGCCTGAAATCCCCGTTGCTGACCGAAGCCACAGGGCCAGAAGCTCCCAG
AGGTCGACCTGACGACGCGAATGCAGGTCGACGAGTCCATCATCGGCACCACCGAGATCGACGAGTCCCTCTACA
GCCGTCAGCTCTATGTCCTGGGTCACGAGGCCATGAAGCGCATGGGCGCCTCCAACGTGCTCATCGTCGGTCTGA
GGGGCCTCGGCGTCGAGATCGCAAAGAACATCGCCCTGGCTGGCGTCAAGAGTCTTACGCTCTACGATCCTGCTC
CTGTTCAGCTGGCCGATCTGTCCGCCCAGTTCTTCCTCACCCCGTCCGACGTTGGCAAGCCCAGGGATCAGGTGA
CGGCGCCGCGCGTGGCCGAGCTCAACGCCTACACTCCCATCAAGCTGCACCAGTCATCCGGGTACGTCGTCTTCC
CAGAATGTGCTGTGAATTTCTCATCTGATGCCTCTAGCAGACTGGACGCGGATCCTAGCCAGTTCGACAAGTATC
AAGTCGTCGTCCTCACCAACCTGCTCATCTCGTCCCAGAAAGCCATTGGAGACTACTGTCATTCCAAGGGCATCT
ACGTCGTCATCGTCAACACCTTCGGCCTGTTTGGCTCCATATTCTGTGACTTTGGAGAAAATTTCACCGTCATCG
ACCCGACGGGCGAGACGCCTCTGAGCGGAATAGTCGCCGGCATCGACGAGGACGGCACCGTATCGGCCCTCGACG
AGGTGCGCCACGACTTGGAGGATGGCGACTACGTCACCTTTTCCGAGTTGGAGGGCATGGAAGGCCTCAACGGGT
GCGAGCCTCGCAAAATCAGCGTCAAAGGGCCCTACACCTTTTCCATCGGCGACGTGTCGGGCCTCGGCACCTACA
AGCGTGGCGGAATGTATCAGCAGGTCAAGATGCCTAAGCCCGTCAACTTCAAGAGCTTCACGGCCTCTCTCAAGG
AGCCCGAGTTCCTCGTGTCCGACTTTGCCAAGTTCGACCGGCCTCAGCAGCTGCACCTCGGATTCCAGGCCCTGG
AGGCCTTTCAGGTGGCCAAGGGACGACTGCCGAAGCCCATGAACGAGGAAGACGCCGCGGTGATGCTGGGCGCCG
TCAAGAAGTTTGCCCAGGAGCAGTCGCTCGACCTGGAACTGAACGAGAAGCTGCTGAAAGAGCTCAGCTTCCAGG
CCACGGGTGATCTCAGCGCCATGGCGGCCTTTTTCGGTGGCATCGCGGCGCAAGAGGTGCTCAAGGCCGTCTCGG
GCAAGTTCCAGCCCATCTGCCAGTGGATGTACTTTGACTCGCTCGAGTCGCTGCCCGAGTCGACGCCCCGGACGG
CCGAGCTGTGCGCGCCCCGGGGAAGCCGCTACGATGGTCAGATTGCCGTCTTCGGCGCCGAGTTCCAGGATAAGA
TTGCCAACTTGAAGCAGTTCCTGGTGGGCGCGGGCGCCATCGGGTGCGAGATGCTCAAGAACTGGGCCATGATGG
GTCTCGGTACCGGTCCCAGGGGCCAGATTTACGTGACGGACATGGACTCGATCGAAAAGAGCAACCTGAACCGCC
AGTTCCTGTTCCGAGCCGCCGACGTGGGCAGCATGAAGAGCGACTGCGCGGCGCGGGCCGTTCAGCGCATGAACC
CAGACCTTGAGGGCCATATGGTGACGATGAAGGACCGGGTCAGCGCTGACACGGAGCACACGTTTGACGAAACGT
TCTGGCAGGGGCTGGACGGAGTGACGAACGCGCTGGACAACGTCGAGGCTCGGACCTACGTCGACCGGCGCTGCG
TCTTCTTCCGCAAGCCCCTGCTGGAGAGCGGCACGCTGGGCACCAAGGGCAACACGCAGGTGGTTCTCCCGCACC
TGACGGAGTCGTACTCGTCGTCGCAGGATCCGCCGGAGAAGGAGTTTCCCATGTGCACGATCCGCAGCTTTCCGA
ACCGAATCGAGCATACGATTGCGTGGGCCAAGGAGTACATGTTTGAAAAGTCGTTTGTTAAGGCGCCGCAGACGG
TGAACCTATACCTGACGCAGCCCAAGTTCCTCGAGACGGCCATGAAGCAGGGCGGCAACCAGAAGGAGACGATGG
AGACGATCCGAAACTACCTGACGACGGAGCGACCACGAACATTCGAGGACTGCATTGCCTGGGCGCGGATGCTGT
TCGAGACGGAGTTCTCCAACAAGATCCAGCAGCTGCTGTACAACTTTCCCAAGGACTCGGTGACGTCGAGCGGCA
CGCCCTTTTGGTCAGGGCCGAAGCGAGCTCCGGATCCGCTCAAGTTTGACGCCAACAACCCGACGCACTTTGGCT
TCATCGTGGCGGCGGCCAACCTGCACGCCTTCAACTTCAACATCAAGTCTCCGGGCATGGACAGGTCCGTCTACG
TGAGGGAGCTGGACAATGTCATTGTGCCCGACTTTGCACCGGATGCCAATGTCAAGATTCAGGCTGATGACAAGG
AGCCGGTGAGCGAGATCAGTGTGGTTTCTGTTGCTCCCGAGGTGCTGATGATAAATTTCAAGGATCCCACTTCGT
TTGACGATACGGACGAGGTTCGCAAAATCATGGCGAGCATCCCGTCGCCCAGCTCGCTGGCGGGCTTCCAGCTGC
AGCCTGTCGAGTTCGAGAAGGACGACGACTCGAATCACCACATCGACTTCATTACGGCGTGCAGCAACCTGCGGG
CGGAGAACTACAAGATTGAGGCAGCGGACCGGCACAAGACCAAGTTTATCGCGGGCAAGATTATCCCGGCCATCG
CGACGACGACAGCGCTGGTGACGGGCCTCGTGGTGCTGGAGCTGTTCAAGATTATAGACGGCAAGCAGGATCTCG
AGCAGTACAAGAACGGCTTCATCAACCTGGCGCTTCCCTTTTTCGGCTTCAGCGAGCCCATCCAGAGCCCCAAGG
TGGAGTACCAAGGCCCGGACGGCAAGGTGACGCTGGACAAGATCTGGGACCGGTTCGAGATTGACGACGTGACGC
TGCAGCAGCTGCTCGACTATTTCAAGGCCAAGGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail