Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|380
Gene name
LocationContig_110:10417..14510
Strand+
Gene length (bp)4093
Transcript length (bp)3927
Coding sequence length (bp)3927
Protein length (aa) 1309

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 2.6E-18 122 294
PF00069 Pkinase Protein kinase domain 8.9E-18 121 291

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q97IC2|PKN2_CLOAB Probable serine/threonine-protein kinase CA_C1728 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1728 PE=3 SV=1 164 367 5.0E-12
sp|Q8XJL8|PKN2_CLOPE Probable serine/threonine-protein kinase CPE1738 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE1738 PE=3 SV=1 138 380 5.0E-12
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 899 1199 8.0E-12
sp|Q9FIL7|CRCK1_ARATH Calmodulin-binding receptor-like cytoplasmic kinase 1 OS=Arabidopsis thaliana GN=CRCK1 PE=1 SV=1 140 284 2.0E-11
sp|Q54XQ2|RCKA_DICDI RGS domain-containing serine/threonine-protein kinase A OS=Dictyostelium discoideum GN=rckA PE=1 SV=1 128 290 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q97IC2|PKN2_CLOAB Probable serine/threonine-protein kinase CA_C1728 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1728 PE=3 SV=1 164 367 5.0E-12
sp|Q8XJL8|PKN2_CLOPE Probable serine/threonine-protein kinase CPE1738 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE1738 PE=3 SV=1 138 380 5.0E-12
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 899 1199 8.0E-12
sp|Q9FIL7|CRCK1_ARATH Calmodulin-binding receptor-like cytoplasmic kinase 1 OS=Arabidopsis thaliana GN=CRCK1 PE=1 SV=1 140 284 2.0E-11
sp|Q54XQ2|RCKA_DICDI RGS domain-containing serine/threonine-protein kinase A OS=Dictyostelium discoideum GN=rckA PE=1 SV=1 128 290 2.0E-10
sp|C0LGF5|Y1341_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2 100 363 4.0E-10
sp|Q8VZJ9|CRCK2_ARATH Calmodulin-binding receptor-like cytoplasmic kinase 2 OS=Arabidopsis thaliana GN=CRCK2 PE=2 SV=1 87 284 8.0E-10
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 163 302 4.0E-09
sp|Q67E01|DUSTY_XENLA Dual serine/threonine and tyrosine protein kinase OS=Xenopus laevis GN=dstyk PE=2 SV=1 60 280 5.0E-09
sp|Q9SR05|ANX1_ARATH Receptor-like protein kinase ANXUR1 OS=Arabidopsis thaliana GN=ANX1 PE=2 SV=1 58 299 8.0E-09
sp|Q6XUX0|DUSTY_CHICK Dual serine/threonine and tyrosine protein kinase OS=Gallus gallus GN=DSTYK PE=2 SV=1 60 280 1.0E-08
sp|Q67E00|DUSTY_XENTR Dual serine/threonine and tyrosine protein kinase OS=Xenopus tropicalis GN=dstyk PE=2 SV=1 60 294 1.0E-08
sp|Q9ASQ5|CRCK3_ARATH Calmodulin-binding receptor-like cytoplasmic kinase 3 OS=Arabidopsis thaliana GN=CRCK3 PE=2 SV=1 102 284 2.0E-08
sp|Q4VSN3|DUSTY_TETNG Dual serine/threonine and tyrosine protein kinase OS=Tetraodon nigroviridis GN=dstyk PE=2 SV=1 60 280 3.0E-08
sp|Q9FID9|Y5389_ARATH Probable receptor-like protein kinase At5g38990 OS=Arabidopsis thaliana GN=At5g38990 PE=2 SV=1 163 423 5.0E-08
sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 137 284 6.0E-08
sp|F1RDG9|FYNB_DANRE Tyrosine-protein kinase fynb OS=Danio rerio GN=fynb PE=2 SV=1 65 292 7.0E-08
sp|Q9T020|Y4391_ARATH Probable receptor-like protein kinase At4g39110 OS=Arabidopsis thaliana GN=At4g39110 PE=3 SV=1 102 314 7.0E-08
sp|C0LGR6|Y4291_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g29180 OS=Arabidopsis thaliana GN=At4g29180 PE=2 SV=2 163 280 8.0E-08
sp|Q8RY67|WAKLO_ARATH Wall-associated receptor kinase-like 14 OS=Arabidopsis thaliana GN=WAKL14 PE=2 SV=2 95 284 9.0E-08
sp|Q9SJT0|Y2214_ARATH Probable receptor-like protein kinase At2g21480 OS=Arabidopsis thaliana GN=At2g21480 PE=3 SV=1 102 314 9.0E-08
sp|A2CI34|DUSTY_PIMPR Dual serine/threonine and tyrosine protein kinase OS=Pimephales promelas GN=dstyk PE=2 SV=1 60 280 1.0E-07
sp|Q6XUX2|DUSTY_RAT Dual serine/threonine and tyrosine protein kinase OS=Rattus norvegicus GN=Dstyk PE=2 SV=1 121 280 1.0E-07
sp|Q4VSN1|DUSTY_DANRE Dual serine/threonine and tyrosine protein kinase OS=Danio rerio GN=dstyk PE=2 SV=1 60 294 1.0E-07
sp|Q9FZB1|Y5188_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51880 OS=Arabidopsis thaliana GN=At1g51880 PE=2 SV=1 147 286 1.0E-07
sp|P54744|PKNB_MYCLE Serine/threonine-protein kinase PknB OS=Mycobacterium leprae (strain TN) GN=pknB PE=3 SV=3 147 354 1.0E-07
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 875 1193 2.0E-07
sp|Q55CY9|GDT8_DICDI Probable serine/threonine-protein kinase gdt8 OS=Dictyostelium discoideum GN=gdt8 PE=3 SV=1 163 291 2.0E-07
sp|Q9XA16|PKNX_STRCO Probable serine/threonine-protein kinase SCO3848 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3848 PE=3 SV=1 145 354 2.0E-07
sp|D7UPN3|CERK1_ORYSJ Chitin elicitor receptor kinase 1 OS=Oryza sativa subsp. japonica GN=CERK1 PE=1 SV=1 113 284 2.0E-07
sp|Q9SA72|Y1357_ARATH Probable receptor-like protein kinase At1g30570 OS=Arabidopsis thaliana GN=At1g30570 PE=3 SV=1 55 303 2.0E-07
sp|Q4VSN2|DUSTY_TAKRU Dual serine/threonine and tyrosine protein kinase OS=Takifugu rubripes GN=dstyk PE=2 SV=1 60 280 2.0E-07
sp|A1Y2K1|FYN_PIG Tyrosine-protein kinase Fyn OS=Sus scrofa GN=FYN PE=2 SV=2 65 292 2.0E-07
sp|Q6XUX1|DUSTY_MOUSE Dual serine/threonine and tyrosine protein kinase OS=Mus musculus GN=Dstyk PE=1 SV=1 121 280 3.0E-07
sp|Q9FID8|Y5900_ARATH Putative receptor-like protein kinase At5g39000 OS=Arabidopsis thaliana GN=At5g39000 PE=3 SV=1 127 423 3.0E-07
sp|Q9FLJ8|Y5613_ARATH Probable receptor-like protein kinase At5g61350 OS=Arabidopsis thaliana GN=At5g61350 PE=2 SV=1 117 314 3.0E-07
sp|C0LGT5|Y5169_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g16900 OS=Arabidopsis thaliana GN=At5g16900 PE=2 SV=1 102 286 3.0E-07
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 790 1193 3.0E-07
sp|C0LGG3|Y5182_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51820 OS=Arabidopsis thaliana GN=At1g51820 PE=2 SV=1 95 286 3.0E-07
sp|Q02977|YRK_CHICK Proto-oncogene tyrosine-protein kinase Yrk OS=Gallus gallus GN=YRK PE=2 SV=2 62 331 3.0E-07
sp|A0JNB0|FYN_BOVIN Tyrosine-protein kinase Fyn OS=Bos taurus GN=FYN PE=2 SV=1 65 292 3.0E-07
sp|P06241|FYN_HUMAN Tyrosine-protein kinase Fyn OS=Homo sapiens GN=FYN PE=1 SV=3 65 292 3.0E-07
sp|Q62844|FYN_RAT Tyrosine-protein kinase Fyn OS=Rattus norvegicus GN=Fyn PE=1 SV=1 65 292 3.0E-07
sp|C0LGD9|Y1756_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g07560 OS=Arabidopsis thaliana GN=At1g07560 PE=2 SV=1 96 286 4.0E-07
sp|Q9SI06|Y5573_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g04300 OS=Arabidopsis thaliana GN=At2g04300 PE=3 SV=2 102 286 4.0E-07
sp|Q4VSN5|DUSTY_PANTR Dual serine/threonine and tyrosine protein kinase OS=Pan troglodytes GN=DSTYK PE=2 SV=1 121 294 4.0E-07
sp|Q6NKZ9|Y4345_ARATH Probable receptor-like serine/threonine-protein kinase At4g34500 OS=Arabidopsis thaliana GN=At4g34500 PE=2 SV=1 137 363 4.0E-07
sp|O22558|STY8_ARATH Serine/threonine-protein kinase STY8 OS=Arabidopsis thaliana GN=STY8 PE=1 SV=2 80 303 4.0E-07
sp|Q6XUX3|DUSTY_HUMAN Dual serine/threonine and tyrosine protein kinase OS=Homo sapiens GN=DSTYK PE=1 SV=2 52 294 4.0E-07
sp|Q4TVR5|DUSTY_BOVIN Dual serine/threonine and tyrosine protein kinase OS=Bos taurus GN=DSTYK PE=2 SV=1 121 294 4.0E-07
sp|Q9FLW0|Y5241_ARATH Probable receptor-like protein kinase At5g24010 OS=Arabidopsis thaliana GN=At5g24010 PE=1 SV=1 102 284 4.0E-07
sp|Q20CR4|DUSTY_MACMU Dual serine/threonine and tyrosine protein kinase OS=Macaca mulatta GN=DSTYK PE=2 SV=1 121 294 5.0E-07
sp|Q4VSN4|DUSTY_CANLF Dual serine/threonine and tyrosine protein kinase OS=Canis lupus familiaris GN=DSTYK PE=2 SV=1 121 294 5.0E-07
sp|C0LGL4|Y2289_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g28960 OS=Arabidopsis thaliana GN=At2g28960 PE=2 SV=1 154 284 5.0E-07
sp|Q3E8W4|ANX2_ARATH Receptor-like protein kinase ANXUR2 OS=Arabidopsis thaliana GN=ANX2 PE=2 SV=1 66 284 5.0E-07
sp|O22187|Y2232_ARATH Probable receptor-like protein kinase At2g23200 OS=Arabidopsis thaliana GN=At2g23200 PE=3 SV=1 104 318 6.0E-07
sp|A8R7E6|CERK1_ARATH Chitin elicitor receptor kinase 1 OS=Arabidopsis thaliana GN=CERK1 PE=1 SV=1 156 284 6.0E-07
sp|Q8RWL6|STY17_ARATH Serine/threonine-protein kinase STY17 OS=Arabidopsis thaliana GN=STY17 PE=1 SV=1 94 303 6.0E-07
sp|P00532|RAF_MSV36 Serine/threonine-protein kinase-transforming protein raf OS=Murine sarcoma virus 3611 GN=V-RAF PE=3 SV=1 190 290 8.0E-07
sp|P09560|RAF1_XENLA RAF proto-oncogene serine/threonine-protein kinase OS=Xenopus laevis GN=raf1 PE=2 SV=1 190 290 9.0E-07
sp|Q9M8T0|Y3288_ARATH Probable inactive receptor kinase At3g02880 OS=Arabidopsis thaliana GN=At3g02880 PE=1 SV=1 140 293 1.0E-06
sp|Q9LK35|THE1_ARATH Receptor-like protein kinase THESEUS 1 OS=Arabidopsis thaliana GN=THE1 PE=1 SV=1 102 314 1.0E-06
sp|A0QNG1|PKNB_MYCS2 Serine/threonine-protein kinase PknB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pknB PE=1 SV=1 147 354 1.0E-06
sp|A6ZU08|TOS3_YEAS7 Serine/threonine-protein kinase TOS3 OS=Saccharomyces cerevisiae (strain YJM789) GN=TOS3 PE=3 SV=1 123 284 1.0E-06
sp|P43637|TOS3_YEAST Serine/threonine-protein kinase TOS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOS3 PE=1 SV=1 123 284 1.0E-06
sp|P27447|YES_XIPHE Tyrosine-protein kinase Yes OS=Xiphophorus helleri GN=yes PE=2 SV=3 96 292 1.0E-06
sp|A1A5H8|YES_DANRE Tyrosine-protein kinase yes OS=Danio rerio GN=yes1 PE=1 SV=1 96 292 1.0E-06
sp|Q54G43|SHKE_DICDI Dual specificity protein kinase shkE OS=Dictyostelium discoideum GN=shkE PE=3 SV=1 188 283 2.0E-06
sp|Q97PA9|STKP2_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 147 307 2.0E-06
sp|Q9LIG2|RLK6_ARATH Receptor-like protein kinase At3g21340 OS=Arabidopsis thaliana GN=At3g21340 PE=1 SV=1 102 286 2.0E-06
sp|C0LGP2|MEE39_ARATH Probable LRR receptor-like serine/threonine-protein kinase MEE39 OS=Arabidopsis thaliana GN=MEE39 PE=2 SV=1 163 286 2.0E-06
sp|Q9FN92|Y5597_ARATH Probable receptor-like protein kinase At5g59700 OS=Arabidopsis thaliana GN=At5g59700 PE=3 SV=1 102 284 2.0E-06
sp|P9WI80|PKNB_MYCTO Serine/threonine-protein kinase PknB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknB PE=3 SV=1 147 316 2.0E-06
sp|P9WI81|PKNB_MYCTU Serine/threonine-protein kinase PknB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknB PE=1 SV=1 147 316 2.0E-06
sp|Q9LX66|HERK_ARATH Receptor-like protein kinase HERK 1 OS=Arabidopsis thaliana GN=HERK1 PE=1 SV=1 102 312 2.0E-06
sp|Q91743|FGFR4_XENLA Fibroblast growth factor receptor 4 OS=Xenopus laevis GN=fgfr4 PE=2 SV=1 117 295 2.0E-06
sp|P0A5S5|PKNB_MYCBO Serine/threonine-protein kinase PknB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknB PE=3 SV=1 147 316 2.0E-06
sp|C0LGQ7|Y4245_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g20450 OS=Arabidopsis thaliana GN=At4g20450 PE=2 SV=1 101 284 3.0E-06
sp|Q55GE6|ROCO7_DICDI Probable serine/threonine-protein kinase roco7 OS=Dictyostelium discoideum GN=roco7 PE=3 SV=1 163 284 3.0E-06
sp|Q9SCZ4|FERON_ARATH Receptor-like protein kinase FERONIA OS=Arabidopsis thaliana GN=FER PE=1 SV=1 98 284 3.0E-06
sp|C0LGI2|Y1677_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g67720 OS=Arabidopsis thaliana GN=At1g67720 PE=2 SV=1 24 284 4.0E-06
sp|Q8KY50|STKP1_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 147 306 4.0E-06
sp|Q9CEF5|PKNB_LACLA Probable serine/threonine-protein kinase PknB OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pknB PE=3 SV=1 164 361 6.0E-06
sp|Q9LSV3|WAKLS_ARATH Putative wall-associated receptor kinase-like 16 OS=Arabidopsis thaliana GN=WAKL16 PE=3 SV=1 68 297 6.0E-06
sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 137 319 6.0E-06
sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=2 SV=1 164 378 8.0E-06
sp|A2CI35|DUSTY_STRPU Dual serine/threonine and tyrosine protein kinase OS=Strongylocentrotus purpuratus GN=DSTYK PE=2 SV=1 188 294 8.0E-06
sp|P0C5E2|Y1839_ARATH Probable serine/threonine-protein kinase At1g18390 OS=Arabidopsis thaliana GN=At1g18390 PE=2 SV=2 164 284 9.0E-06
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 701 1198 9.0E-06
sp|Q9LVI6|RLK90_ARATH Probable inactive receptor kinase RLK902 OS=Arabidopsis thaliana GN=RLK902 PE=1 SV=1 138 284 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0004672 protein kinase activity Yes
GO:0005524 ATP binding Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0043168 anion binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043412 macromolecule modification No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|380
MDFSNSLTFRVRQPDTQHDPSPGKDTPRADKRESTCPNLAAFLAICFANGDESLGLHPVLTNASPSLDDVSLRGG
SFDVRKVKASSFPLRLADDLFRGRDFVVVKHPRPGDSRGLGDEVLSEVGMELQVLRHWAVRRNENVIDLLAVMYH
DAGDEEGSIILPALVLEYAAFGNLKTFQEEGNGHSFEDKIDIAIDTAKGIEALHACGVIHGDVKNSNMLVCKHPT
RKFIVKVSDFGFSFLVTDSQLTGHTEIYCPPESYTAQLDPEQAKQVDVYCYGLLLHSVLKDGTAYYPQGPDAPVG
TAEDFQKMKVSGLMPATLLLNVLMTGPGREPYPLLLLCKVLLYCLLPEPKQRWRDMTTIISLLSLLQGCNDQPNK
SASEKVSAALGAATEAGKGGGDLLASLTTVIRAMLSTMDGQMLTAGPEPIRRQFLATVSTFADTVVANFVASVGE
LEMPMFEVVGAQLRARAQKQLSEITQGSESGPSFLITRLFFSLPSELALCRGHDLIPDFSLLHGIFQKMPWPVQK
AAVQSLSHLHSTTKDKVAKRKAALSLASVYTNGVGVEPDLTKASALVLEAAKLGDERAQTIYINGFFPESSSPPD
VDELTWRTWLSESAMAGNAIALSKLSSLDPAALPAISEARRQAECSVAKSGLGEGRDGSLASLDGDVPSDQLQCI
LLSAVINDNRPAIEKCLELDENLPLTRYHNGEHALLIACRLGNAHAATALISPSTANLADEQGARPFHWLSRLAE
DQHRVMARLLKDNGADPDALGPALTRSDVEQRVQPGRLRWTPLHWAVALDSPSAVRALMEIGCDPTIRAAPDRGT
WDLSPLELASSLCNSASLAALLTNDAVRSQVDKPRPMVEGMAVSITPMFYVVSSRSRWDRIRKHGLEFKKKTRET
LKLLIDNGASSDRVLLTGSQGKMPAVFATAYHSCCADVMASGLELGFGSEMDASCGSLSSGGSALFLAITHRDRA
MFTALVEAGASLDARDEDGMTPLHRAAKENDDVFFARALLDAGVPVEPGEDSPIPTPFQVAVYCRNFAVAKLLFD
SGAERDRMAPRNRRTILGDMLSMHTWNSLERVKFVLNLPDRSGDAASDGFIAARIEEKNISVFHLAAPYISETSS
HRSDITAILVTQLLGKYSEKKHLDSTYGPFSMTAVAVAVENGDYGVVRKLLDAGADPNVADEFGRSPLDLLYHRY
CYPENLPSLEEVDCDDKLAVGRTLQSINENTAEVLSLLKSHRAEARTFCFPNWHHVDSGYRNAAWVMDRLKEKKE
RKVEAEKKEKKTESKKMEGGPDTAAACSPGAHA*
Coding >Ophun1|380
ATGGACTTCTCCAACTCGCTCACCTTTCGCGTCCGCCAGCCCGACACCCAACATGACCCTAGCCCCGGAAAAGAC
ACGCCGCGGGCGGACAAGCGGGAGTCGACGTGTCCCAACCTCGCTGCCTTCTTGGCCATTTGCTTCGCCAACGGG
GACGAGAGTCTAGGTCTTCACCCGGTCCTTACCAACGCTTCGCCCAGCCTTGACGATGTCTCTCTGCGCGGAGGG
TCGTTTGATGTTCGCAAGGTGAAGGCGAGTTCGTTTCCGCTCCGACTGGCGGATGACCTGTTTCGCGGACGGGAC
TTTGTCGTCGTTAAGCATCCGCGGCCGGGGGATAGTCGTGGTCTGGGAGATGAGGTGCTCTCCGAGGTGGGCATG
GAGTTGCAGGTTCTTCGGCACTGGGCTGTCAGGAGGAATGAGAATGTTATCGACTTGCTGGCTGTCATGTATCAT
GACGCTGGCGATGAGGAGGGTTCCATCATTCTTCCTGCTCTGGTGCTTGAGTACGCGGCCTTTGGAAATCTCAAG
ACGTTTCAGGAGGAAGGGAACGGTCACTCCTTTGAGGACAAGATTGACATTGCGATTGATACGGCAAAGGGGATT
GAGGCTTTGCATGCTTGCGGTGTGATTCACGGCGACGTCAAGAACTCCAACATGCTCGTCTGCAAACACCCAACA
CGCAAGTTCATCGTCAAGGTTTCCGACTTTGGCTTCTCCTTTCTCGTCACGGACTCGCAGCTGACGGGGCACACG
GAAATCTATTGCCCTCCTGAGTCGTACACGGCGCAGCTGGATCCCGAGCAGGCGAAGCAGGTCGACGTCTACTGC
TACGGGCTCCTCCTTCATTCCGTTTTGAAGGATGGCACGGCTTATTATCCGCAGGGGCCGGACGCGCCGGTTGGT
ACGGCGGAGGATTTTCAGAAGATGAAGGTTTCGGGGCTGATGCCGGCGACTTTGCTGTTGAATGTGCTCATGACG
GGGCCGGGGAGGGAGCCGTATCCTTTGCTTTTGCTTTGCAAGGTTCTGCTTTATTGCTTGCTGCCGGAGCCGAAG
CAGCGATGGCGAGACATGACGACTATCATTTCTCTTCTCAGTCTTCTTCAGGGCTGCAACGATCAGCCGAACAAG
TCAGCGTCCGAAAAGGTCTCCGCCGCGCTGGGAGCTGCTACCGAAGCCGGGAAAGGAGGAGGCGATCTTTTAGCG
AGCCTGACGACGGTGATACGGGCAATGTTGAGCACCATGGACGGTCAGATGCTCACTGCCGGTCCGGAGCCGATC
CGCCGCCAGTTTCTGGCCACAGTTTCGACCTTTGCGGACACGGTCGTTGCAAATTTCGTTGCTTCCGTCGGGGAG
CTTGAGATGCCCATGTTTGAGGTTGTTGGCGCGCAGTTGCGGGCTCGGGCTCAGAAGCAGCTTTCTGAGATAACG
CAGGGTTCCGAATCTGGGCCGAGTTTCTTGATTACGCGGCTTTTCTTCTCTTTACCGTCTGAGCTTGCTCTATGC
CGCGGCCACGATCTTATACCAGACTTCTCCCTCCTTCACGGCATCTTCCAAAAGATGCCCTGGCCCGTACAAAAA
GCCGCCGTGCAAAGCCTATCACACCTCCACTCGACCACCAAAGATAAAGTCGCCAAGAGAAAAGCAGCCCTGAGC
CTCGCCAGCGTCTACACCAATGGCGTCGGAGTCGAGCCGGACTTGACAAAGGCCTCGGCTCTAGTTCTCGAAGCC
GCCAAGCTTGGAGACGAAAGGGCGCAGACGATTTACATCAATGGCTTCTTTCCCGAGTCGAGCTCGCCTCCAGAT
GTCGATGAACTTACCTGGCGGACTTGGCTTAGCGAGTCGGCCATGGCTGGTAATGCCATTGCATTGTCGAAGCTG
AGCAGCCTGGATCCGGCTGCACTTCCAGCCATTTCGGAAGCCCGTCGACAAGCCGAGTGTTCCGTAGCCAAGTCC
GGCCTCGGAGAAGGCCGTGATGGCTCCTTGGCCAGTCTTGACGGTGATGTTCCAAGTGATCAGCTTCAATGCATC
CTCCTTAGCGCCGTCATCAACGACAACAGGCCAGCGATAGAGAAATGCCTCGAACTCGACGAGAACCTGCCCCTC
ACACGATACCACAACGGCGAACATGCCCTGCTGATAGCATGCAGACTCGGCAACGCTCACGCAGCAACTGCACTC
ATCTCCCCCAGCACTGCTAATCTCGCCGACGAGCAGGGAGCCCGTCCATTTCACTGGCTGAGCCGCCTCGCAGAA
GATCAGCATCGAGTTATGGCCAGGCTCCTCAAAGATAACGGAGCGGATCCTGACGCTCTGGGCCCTGCTCTAACC
CGATCAGATGTTGAGCAGCGGGTACAGCCTGGCCGTCTGAGATGGACGCCTCTTCACTGGGCCGTCGCTCTCGAT
AGTCCGTCTGCCGTTCGAGCCTTGATGGAAATAGGCTGCGACCCGACGATCCGAGCTGCTCCGGACAGAGGAACG
TGGGATCTCAGCCCCTTGGAACTCGCCTCAAGTCTCTGCAACTCAGCTTCTCTCGCGGCTCTGCTCACAAATGAC
GCCGTTCGGTCACAGGTAGACAAGCCTCGACCCATGGTAGAAGGGATGGCTGTCTCAATAACGCCCATGTTCTAC
GTCGTATCCTCAAGATCTCGCTGGGACCGCATCAGAAAACACGGCCTCGAGTTTAAGAAAAAGACGCGTGAAACT
CTCAAGCTACTCATCGACAACGGAGCGAGCTCGGATCGAGTCCTCCTTACAGGCAGCCAGGGTAAGATGCCCGCC
GTCTTTGCAACGGCTTACCACTCGTGTTGCGCCGACGTCATGGCTTCCGGTCTGGAGCTTGGCTTTGGATCCGAG
ATGGATGCCAGCTGTGGCTCGTTATCGAGCGGTGGATCTGCGCTCTTCCTCGCCATCACTCATCGTGATAGAGCC
ATGTTCACTGCGCTGGTCGAGGCTGGGGCGAGCCTTGACGCTCGCGATGAGGATGGTATGACGCCATTGCATAGA
GCAGCCAAGGAAAACGACGATGTCTTCTTCGCTCGCGCTTTGCTGGATGCCGGTGTTCCCGTTGAGCCGGGAGAA
GACTCACCCATTCCAACTCCGTTTCAAGTCGCTGTTTACTGCCGGAACTTTGCGGTTGCTAAGCTGCTGTTCGAC
TCTGGCGCGGAACGTGATCGCATGGCGCCCCGGAACCGGAGGACTATCCTCGGCGATATGCTCTCTATGCATACC
TGGAACTCGCTCGAGCGCGTCAAGTTTGTCCTTAACCTACCAGACCGATCAGGCGATGCTGCCTCAGACGGCTTC
ATCGCCGCTCGTATTGAAGAAAAGAACATCTCCGTCTTCCACCTCGCAGCACCTTATATATCCGAAACATCCAGC
CACCGGTCCGACATCACTGCCATTCTGGTGACGCAGCTGCTTGGCAAGTACAGCGAGAAGAAACACCTTGACTCT
ACTTACGGGCCATTTTCCATGACGGCGGTGGCGGTGGCGGTCGAAAACGGTGACTATGGCGTGGTAAGGAAGCTG
CTCGATGCTGGCGCTGATCCGAACGTGGCTGATGAGTTTGGACGCTCGCCGCTGGATCTGCTTTACCACCGGTAT
TGCTATCCGGAGAATTTACCTTCGCTTGAAGAGGTTGATTGCGATGATAAACTGGCGGTTGGAAGAACGCTGCAG
TCTATTAACGAGAATACGGCCGAAGTGCTGTCGCTACTGAAGAGTCATAGGGCCGAGGCTAGGACGTTTTGCTTT
CCGAACTGGCATCATGTTGACAGTGGCTATCGAAATGCCGCGTGGGTCATGGATCGTTTGAAGGAGAAGAAAGAG
AGGAAGGTTGAAGCTGAGAAGAAGGAGAAGAAGACTGAGTCTAAGAAGATGGAGGGAGGGCCGGACACGGCGGCT
GCGTGTAGCCCGGGTGCTCATGCTTGA
Transcript >Ophun1|380
ATGGACTTCTCCAACTCGCTCACCTTTCGCGTCCGCCAGCCCGACACCCAACATGACCCTAGCCCCGGAAAAGAC
ACGCCGCGGGCGGACAAGCGGGAGTCGACGTGTCCCAACCTCGCTGCCTTCTTGGCCATTTGCTTCGCCAACGGG
GACGAGAGTCTAGGTCTTCACCCGGTCCTTACCAACGCTTCGCCCAGCCTTGACGATGTCTCTCTGCGCGGAGGG
TCGTTTGATGTTCGCAAGGTGAAGGCGAGTTCGTTTCCGCTCCGACTGGCGGATGACCTGTTTCGCGGACGGGAC
TTTGTCGTCGTTAAGCATCCGCGGCCGGGGGATAGTCGTGGTCTGGGAGATGAGGTGCTCTCCGAGGTGGGCATG
GAGTTGCAGGTTCTTCGGCACTGGGCTGTCAGGAGGAATGAGAATGTTATCGACTTGCTGGCTGTCATGTATCAT
GACGCTGGCGATGAGGAGGGTTCCATCATTCTTCCTGCTCTGGTGCTTGAGTACGCGGCCTTTGGAAATCTCAAG
ACGTTTCAGGAGGAAGGGAACGGTCACTCCTTTGAGGACAAGATTGACATTGCGATTGATACGGCAAAGGGGATT
GAGGCTTTGCATGCTTGCGGTGTGATTCACGGCGACGTCAAGAACTCCAACATGCTCGTCTGCAAACACCCAACA
CGCAAGTTCATCGTCAAGGTTTCCGACTTTGGCTTCTCCTTTCTCGTCACGGACTCGCAGCTGACGGGGCACACG
GAAATCTATTGCCCTCCTGAGTCGTACACGGCGCAGCTGGATCCCGAGCAGGCGAAGCAGGTCGACGTCTACTGC
TACGGGCTCCTCCTTCATTCCGTTTTGAAGGATGGCACGGCTTATTATCCGCAGGGGCCGGACGCGCCGGTTGGT
ACGGCGGAGGATTTTCAGAAGATGAAGGTTTCGGGGCTGATGCCGGCGACTTTGCTGTTGAATGTGCTCATGACG
GGGCCGGGGAGGGAGCCGTATCCTTTGCTTTTGCTTTGCAAGGTTCTGCTTTATTGCTTGCTGCCGGAGCCGAAG
CAGCGATGGCGAGACATGACGACTATCATTTCTCTTCTCAGTCTTCTTCAGGGCTGCAACGATCAGCCGAACAAG
TCAGCGTCCGAAAAGGTCTCCGCCGCGCTGGGAGCTGCTACCGAAGCCGGGAAAGGAGGAGGCGATCTTTTAGCG
AGCCTGACGACGGTGATACGGGCAATGTTGAGCACCATGGACGGTCAGATGCTCACTGCCGGTCCGGAGCCGATC
CGCCGCCAGTTTCTGGCCACAGTTTCGACCTTTGCGGACACGGTCGTTGCAAATTTCGTTGCTTCCGTCGGGGAG
CTTGAGATGCCCATGTTTGAGGTTGTTGGCGCGCAGTTGCGGGCTCGGGCTCAGAAGCAGCTTTCTGAGATAACG
CAGGGTTCCGAATCTGGGCCGAGTTTCTTGATTACGCGGCTTTTCTTCTCTTTACCGTCTGAGCTTGCTCTATGC
CGCGGCCACGATCTTATACCAGACTTCTCCCTCCTTCACGGCATCTTCCAAAAGATGCCCTGGCCCGTACAAAAA
GCCGCCGTGCAAAGCCTATCACACCTCCACTCGACCACCAAAGATAAAGTCGCCAAGAGAAAAGCAGCCCTGAGC
CTCGCCAGCGTCTACACCAATGGCGTCGGAGTCGAGCCGGACTTGACAAAGGCCTCGGCTCTAGTTCTCGAAGCC
GCCAAGCTTGGAGACGAAAGGGCGCAGACGATTTACATCAATGGCTTCTTTCCCGAGTCGAGCTCGCCTCCAGAT
GTCGATGAACTTACCTGGCGGACTTGGCTTAGCGAGTCGGCCATGGCTGGTAATGCCATTGCATTGTCGAAGCTG
AGCAGCCTGGATCCGGCTGCACTTCCAGCCATTTCGGAAGCCCGTCGACAAGCCGAGTGTTCCGTAGCCAAGTCC
GGCCTCGGAGAAGGCCGTGATGGCTCCTTGGCCAGTCTTGACGGTGATGTTCCAAGTGATCAGCTTCAATGCATC
CTCCTTAGCGCCGTCATCAACGACAACAGGCCAGCGATAGAGAAATGCCTCGAACTCGACGAGAACCTGCCCCTC
ACACGATACCACAACGGCGAACATGCCCTGCTGATAGCATGCAGACTCGGCAACGCTCACGCAGCAACTGCACTC
ATCTCCCCCAGCACTGCTAATCTCGCCGACGAGCAGGGAGCCCGTCCATTTCACTGGCTGAGCCGCCTCGCAGAA
GATCAGCATCGAGTTATGGCCAGGCTCCTCAAAGATAACGGAGCGGATCCTGACGCTCTGGGCCCTGCTCTAACC
CGATCAGATGTTGAGCAGCGGGTACAGCCTGGCCGTCTGAGATGGACGCCTCTTCACTGGGCCGTCGCTCTCGAT
AGTCCGTCTGCCGTTCGAGCCTTGATGGAAATAGGCTGCGACCCGACGATCCGAGCTGCTCCGGACAGAGGAACG
TGGGATCTCAGCCCCTTGGAACTCGCCTCAAGTCTCTGCAACTCAGCTTCTCTCGCGGCTCTGCTCACAAATGAC
GCCGTTCGGTCACAGGTAGACAAGCCTCGACCCATGGTAGAAGGGATGGCTGTCTCAATAACGCCCATGTTCTAC
GTCGTATCCTCAAGATCTCGCTGGGACCGCATCAGAAAACACGGCCTCGAGTTTAAGAAAAAGACGCGTGAAACT
CTCAAGCTACTCATCGACAACGGAGCGAGCTCGGATCGAGTCCTCCTTACAGGCAGCCAGGGTAAGATGCCCGCC
GTCTTTGCAACGGCTTACCACTCGTGTTGCGCCGACGTCATGGCTTCCGGTCTGGAGCTTGGCTTTGGATCCGAG
ATGGATGCCAGCTGTGGCTCGTTATCGAGCGGTGGATCTGCGCTCTTCCTCGCCATCACTCATCGTGATAGAGCC
ATGTTCACTGCGCTGGTCGAGGCTGGGGCGAGCCTTGACGCTCGCGATGAGGATGGTATGACGCCATTGCATAGA
GCAGCCAAGGAAAACGACGATGTCTTCTTCGCTCGCGCTTTGCTGGATGCCGGTGTTCCCGTTGAGCCGGGAGAA
GACTCACCCATTCCAACTCCGTTTCAAGTCGCTGTTTACTGCCGGAACTTTGCGGTTGCTAAGCTGCTGTTCGAC
TCTGGCGCGGAACGTGATCGCATGGCGCCCCGGAACCGGAGGACTATCCTCGGCGATATGCTCTCTATGCATACC
TGGAACTCGCTCGAGCGCGTCAAGTTTGTCCTTAACCTACCAGACCGATCAGGCGATGCTGCCTCAGACGGCTTC
ATCGCCGCTCGTATTGAAGAAAAGAACATCTCCGTCTTCCACCTCGCAGCACCTTATATATCCGAAACATCCAGC
CACCGGTCCGACATCACTGCCATTCTGGTGACGCAGCTGCTTGGCAAGTACAGCGAGAAGAAACACCTTGACTCT
ACTTACGGGCCATTTTCCATGACGGCGGTGGCGGTGGCGGTCGAAAACGGTGACTATGGCGTGGTAAGGAAGCTG
CTCGATGCTGGCGCTGATCCGAACGTGGCTGATGAGTTTGGACGCTCGCCGCTGGATCTGCTTTACCACCGGTAT
TGCTATCCGGAGAATTTACCTTCGCTTGAAGAGGTTGATTGCGATGATAAACTGGCGGTTGGAAGAACGCTGCAG
TCTATTAACGAGAATACGGCCGAAGTGCTGTCGCTACTGAAGAGTCATAGGGCCGAGGCTAGGACGTTTTGCTTT
CCGAACTGGCATCATGTTGACAGTGGCTATCGAAATGCCGCGTGGGTCATGGATCGTTTGAAGGAGAAGAAAGAG
AGGAAGGTTGAAGCTGAGAAGAAGGAGAAGAAGACTGAGTCTAAGAAGATGGAGGGAGGGCCGGACACGGCGGCT
GCGTGTAGCCCGGGTGCTCATGCTTGA
Gene >Ophun1|380
ATGGACTTCTCCAACTCGCTCACCTTTCGCGTCCGCCAGCCCGACACCCAACATGACCCTAGCCCCGGAAAAGAC
ACGCCGCGGGCGGACAAGCGGGAGTCGACGTGTCCCAACCTCGCTGCCTTCTTGGCCATTTGCTTCGCCAACGGG
GACGAGAGTCTAGGTCTTCACCCGGTCCTTACCAACGCTTCGCCCAGCCTTGACGATGTCTCTCTGCGCGGAGGG
TCGTTTGATGTTCGCAAGGTGAAGGCGAGTTCGTTTCCGCTCCGACTGGCGGATGACCTGTTTCGCGGACGGGAC
TTTGTCGTCGTTAAGCATCCGCGGCCGGGGGATAGTCGTGGTCTGGGAGATGAGGTGCTCTCCGAGGTGGGCATG
GAGTTGCAGGTTCTTCGGCACTGGGCTGTCAGGAGGAATGAGAATGTTATCGACTTGCTGGCTGTCATGTATCAT
GACGCTGGCGATGAGGAGGGTTCCATCATTCTTCCTGCTCTGGTGCTTGAGTACGCGGCCTTTGGAAATCTCAAG
ACGTTTCAGGAGGAAGGGAACGGTCACTCCTTTGAGGACAAGATTGACATTGCGATTGATACGGCAAAGGGGATT
GAGGCTTTGCATGCTTGCGGTGTGATTCACGGCGACGTCAAGAACTCCAACATGCTCGTCTGCAAACACCCAACA
CGCAAGTTCATCGTCAAGGTTTCCGACTTTGGCTTCTCCTTTCTCGTCACGGACTCGCAGCTGACGGGGCACACG
GAAATCTATTGCCCTCCTGAGTCGTACACGGCGCAGCTGGATCCCGAGCAGGCGAAGCAGGTCGACGTCTACTGC
TACGGGCTCCTCCTTCATTCCGTTTTGAAGGATGGCACGGCTTATTATCCGCAGGGGCCGGACGCGCCGGTTGGT
ACGGCGGAGGATTTTCAGAAGATGAAGGTTTCGGGGCTGATGCCGGCGACTTTGCTGTTGAATGTGCTCATGACG
GGGCCGGGGAGGGAGCCGTATCCTTTGCTTTTGCTTTGCAAGGTTCTGCTTTATTGCTTGCTGCCGGAGCCGAAG
CAGCGATGGCGAGACATGACGACTATCATTTCTCTTCTCAGTCTTCTTCAGGGCTGCAACGATCAGCCGAACAAG
TCAGCGTCCGAAAAGGTCTCCGCCGCGCTGGGAGCTGCTACCGAAGCCGGGAAAGGAGGAGGCGATCTTTTAGCG
AGCCTGACGACGGTGATACGGGCAATGTTGAGCACCATGGACGGTCAGATGCTCACTGCCGGTCCGGAGCCGATC
CGCCGCCAGTTTCTGGCCACAGTTTCGACCTTTGCGGACACGGTCGTTGCAAATTTCGTTGCTTCCGTCGGGGAG
CTTGAGATGCCCATGTTTGAGGTTGTTGGCGCGCAGTTGCGGGCTCGGGCTCAGAAGCAGCTTTCTGAGATAACG
CAGGGTTCCGAATCTGGGCCGAGTTTCTTGATTACGCGGCTTTGTCAGTTGTTGCTTGATTGTGTTGGTTTGTGC
TCTGGGATGGCTCTGTCCAAGTCTTCGTACGTATATGGTGTTGACTGAGTGCTCAAAGTTGTTGTTAACCTTTAA
CAACAGCGTTCAGTCTTTACCGTCTGAGCTTGCTCTATGCCGCGGCCACGATCTTATACCAGACGTGAGATCCAC
CAACGCCGCTTCACTCTACTCATGTCTAACATACATTCAGTTCTCCCTCCTTCACGGCATCTTCCAAAAGATGCC
CTGGCCCGTACAAAAAGCCGCCGTGCAAAGCCTATCACACCTCCACTCGACCACCAAAGATAAAGTCGCCAAGAG
AAAAGCAGCCCTGAGCCTCGCCAGCGTCTACACCAATGGCGTCGGAGTCGAGCCGGACTTGACAAAGGCCTCGGC
TCTAGTTCTCGAAGCCGCCAAGCTTGGAGACGAAAGGGCGCAGACGATTTACATCAATGGCTTCTTTCCCGAGTC
GAGCTCGCCTCCAGATGTCGATGAACTTACCTGGCGGACTTGGCTTAGCGAGTCGGCCATGGCTGGTAATGCCAT
TGCATTGTCGAAGCTGAGCAGCCTGGATCCGGCTGCACTTCCAGCCATTTCGGAAGCCCGTCGACAAGCCGAGTG
TTCCGTAGCCAAGTCCGGCCTCGGAGAAGGCCGTGATGGCTCCTTGGCCAGTCTTGACGGTGATGTTCCAAGTGA
TCAGCTTCAATGCATCCTCCTTAGCGCCGTCATCAACGACAACAGGCCAGCGATAGAGAAATGCCTCGAACTCGA
CGAGAACCTGCCCCTCACACGATACCACAACGGCGAACATGCCCTGCTGATAGCATGCAGACTCGGCAACGCTCA
CGCAGCAACTGCACTCATCTCCCCCAGCACTGCTAATCTCGCCGACGAGCAGGGAGCCCGTCCATTTCACTGGCT
GAGCCGCCTCGCAGAAGATCAGCATCGAGTTATGGCCAGGCTCCTCAAAGATAACGGAGCGGATCCTGACGCTCT
GGGCCCTGCTCTAACCCGATCAGATGTTGAGCAGCGGGTACAGCCTGGCCGTCTGAGATGGACGCCTCTTCACTG
GGCCGTCGCTCTCGATAGTCCGTCTGCCGTTCGAGCCTTGATGGAAATAGGCTGCGACCCGACGATCCGAGCTGC
TCCGGACAGAGGAACGTGGGATCTCAGCCCCTTGGAACTCGCCTCAAGTCTCTGCAACTCAGCTTCTCTCGCGGC
TCTGCTCACAAATGACGCCGTTCGGTCACAGGTAGACAAGCCTCGACCCATGGTAGAAGGGATGGCTGTCTCAAT
AACGCCCATGTTCTACGTCGTATCCTCAAGATCTCGCTGGGACCGCATCAGAAAACACGGCCTCGAGTTTAAGAA
AAAGACGCGTGAAACTCTCAAGCTACTCATCGACAACGGAGCGAGCTCGGATCGAGTCCTCCTTACAGGCAGCCA
GGGTAAGATGCCCGCCGTCTTTGCAACGGCTTACCACTCGTGTTGCGCCGACGTCATGGCTTCCGGTCTGGAGCT
TGGCTTTGGATCCGAGATGGATGCCAGCTGTGGCTCGTTATCGAGCGGTGGATCTGCGCTCTTCCTCGCCATCAC
TCATCGTGATAGAGCCATGTTCACTGCGCTGGTCGAGGCTGGGGCGAGCCTTGACGCTCGCGATGAGGATGGTAT
GACGCCATTGCATAGAGCAGCCAAGGAAAACGACGATGTCTTCTTCGCTCGCGCTTTGCTGGATGCCGGTGTTCC
CGTTGAGCCGGGAGAAGACTCACCCATTCCAACTCCGTTTCAAGTCGCTGTTTACTGCCGGAACTTTGCGGTTGC
TAAGCTGCTGTTCGACTCTGGCGCGGAACGTGATCGCATGGCGCCCCGGAACCGGAGGACTATCCTCGGCGATAT
GCTCTCTATGCATACCTGGAACTCGCTCGAGCGCGTCAAGTTTGTCCTTAACCTACCAGACCGATCAGGCGATGC
TGCCTCAGACGGCTTCATCGCCGCTCGTATTGAAGAAAAGAACATCTCCGTCTTCCACCTCGCAGCACCTTATAT
ATCCGAAACATCCAGCCACCGGTCCGACATCACTGCCATTCTGGTGACGCAGCTGCTTGGCAAGTACAGCGAGAA
GAAACACCTTGACTCTACTTACGGGCCATTTTCCATGACGGCGGTGGCGGTGGCGGTCGAAAACGGTGACTATGG
CGTGGTAAGGAAGCTGCTCGATGCTGGCGCTGATCCGAACGTGGCTGATGAGTTTGGACGCTCGCCGCTGGATCT
GCTTTACCACCGGTATTGCTATCCGGAGAATTTACCTTCGCTTGAAGAGGTTGATTGCGATGATAAACTGGCGGT
TGGAAGAACGCTGCAGTCTATTAACGAGAATACGGCCGAAGTGCTGTCGCTACTGAAGAGTCATAGGGCCGAGGC
TAGGACGTTTTGCTTTCCGAACTGGCATCATGTTGACAGTGGCTATCGAAATGCCGCGTGGGTCATGGATCGTTT
GAAGGAGAAGAAAGAGAGGAAGGTTGAAGCTGAGAAGAAGGAGAAGAAGACTGAGTCTAAGAAGATGGAGGGAGG
GCCGGACACGGCGGCTGCGTGTAGCCCGGGTGCTCATGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail