Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3799
Gene name
LocationContig_340:8593..9969
Strand-
Gene length (bp)1376
Transcript length (bp)1260
Coding sequence length (bp)1260
Protein length (aa) 420

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08059 SEP SEP domain 7.9E-25 223 296
PF14555 UBA_4 UBA-like domain 1.6E-09 10 50
PF00789 UBX UBX domain 3.2E-09 339 405

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0C8Q0|UBX1_EMENI UBX domain-containing protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ubx1 PE=3 SV=1 5 418 2.0E-91
sp|Q9UT81|UBX3_SCHPO UBX domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubx3 PE=1 SV=1 8 397 1.0E-44
sp|Q14CS0|UBX2B_HUMAN UBX domain-containing protein 2B OS=Homo sapiens GN=UBXN2B PE=1 SV=1 140 402 8.0E-35
sp|Q5RBG3|NSF1C_PONAB NSFL1 cofactor p47 OS=Pongo abelii GN=NSFL1C PE=2 SV=1 6 404 1.0E-34
sp|Q9UNZ2|NSF1C_HUMAN NSFL1 cofactor p47 OS=Homo sapiens GN=NSFL1C PE=1 SV=2 6 404 1.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0C8Q0|UBX1_EMENI UBX domain-containing protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ubx1 PE=3 SV=1 5 418 2.0E-91
sp|Q9UT81|UBX3_SCHPO UBX domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubx3 PE=1 SV=1 8 397 1.0E-44
sp|Q14CS0|UBX2B_HUMAN UBX domain-containing protein 2B OS=Homo sapiens GN=UBXN2B PE=1 SV=1 140 402 8.0E-35
sp|Q5RBG3|NSF1C_PONAB NSFL1 cofactor p47 OS=Pongo abelii GN=NSFL1C PE=2 SV=1 6 404 1.0E-34
sp|Q9UNZ2|NSF1C_HUMAN NSFL1 cofactor p47 OS=Homo sapiens GN=NSFL1C PE=1 SV=2 6 404 1.0E-34
sp|Q3SZC4|NSF1C_BOVIN NSFL1 cofactor p47 OS=Bos taurus GN=NSFL1C PE=2 SV=1 6 402 3.0E-34
sp|Q5ZK10|NSF1C_CHICK NSFL1 cofactor p47 OS=Gallus gallus GN=NSFL1C PE=2 SV=1 8 404 6.0E-34
sp|P0C627|UBX2B_RAT UBX domain-containing protein 2B OS=Rattus norvegicus GN=Ubxn2b PE=1 SV=1 135 404 3.0E-33
sp|Q0KL01|UBX2B_MOUSE UBX domain-containing protein 2B OS=Mus musculus GN=Ubxn2b PE=1 SV=2 135 404 7.0E-33
sp|O35987|NSF1C_RAT NSFL1 cofactor p47 OS=Rattus norvegicus GN=Nsfl1c PE=1 SV=1 6 402 7.0E-33
sp|Q9CZ44|NSF1C_MOUSE NSFL1 cofactor p47 OS=Mus musculus GN=Nsfl1c PE=1 SV=1 6 402 2.0E-32
sp|Q5ZLK2|UBX2B_CHICK UBX domain-containing protein 2B OS=Gallus gallus GN=UBXN2B PE=2 SV=1 217 402 3.0E-30
sp|P34223|UBX1_YEAST UBX domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHP1 PE=1 SV=1 10 404 1.0E-29
sp|Q54BQ5|NSF1C_DICDI NSFL1 cofactor p47 homolog OS=Dictyostelium discoideum GN=nsfl1c PE=3 SV=1 8 393 2.0E-29
sp|Q0P3R5|UBX2B_XENLA UBX domain-containing protein 2B OS=Xenopus laevis GN=ubxn2b PE=2 SV=1 157 398 4.0E-29
sp|Q9SUG6|PUX3_ARATH Plant UBX domain-containing protein 3 OS=Arabidopsis thaliana GN=PUX3 PE=1 SV=1 136 397 8.0E-26
sp|Q8RWU7|PUX4_ARATH Plant UBX domain-containing protein 4 OS=Arabidopsis thaliana GN=PUX4 PE=1 SV=1 136 397 2.0E-23
sp|Q7Y175|PUX5_ARATH Plant UBX domain-containing protein 5 OS=Arabidopsis thaliana GN=PUX5 PE=1 SV=1 79 394 2.0E-21
sp|Q99KJ0|UBX2A_MOUSE UBX domain-containing protein 2A OS=Mus musculus GN=Ubxn2a PE=1 SV=1 223 402 1.0E-16
sp|P68543|UBX2A_HUMAN UBX domain-containing protein 2A OS=Homo sapiens GN=UBXN2A PE=2 SV=1 223 402 1.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3799
MAEQNAPDRDEMVRDFCDMCEASPEMATQYLAAHNWDYLAACNTFFSEDDDKRLDEGPSQDRPEEPYTGPRTVDG
RPAPQAYRRSRNNEPAAKKKGVATLASLASGSQQGGGDDDDDDVDDDDLDGDTEDGRGNLFAGGEKSGLAVQDPK
QEGGSRQIINDILAKARASNSRPDAASEAGPSRSSLFRGTGMTLGGEGVQSRAVPDPLGPVRPANAQPLERVLHI
WQDGFSIDDGELRRYDDPANRADLQMIRSGRAPLHLMNVQHDQLVDVKLHQHDTPYSPPPKQYKPFGGAGHRLGS
PVPGGASEAPATTAGPSTTTSTTAAATTSNSSEPAVDSSQPTVMIRIQLPDGTRLPARFNTTQTLGDVYGFIQGA
SPETRTRAWVLVTTFPNKEHKDKELVLGDMPEFKRGGTAVVKWT*
Coding >Ophun1|3799
ATGGCCGAGCAAAACGCCCCAGACCGGGATGAGATGGTCCGCGACTTCTGCGACATGTGCGAAGCCAGCCCTGAG
ATGGCCACGCAGTATCTCGCGGCCCATAACTGGGATTATCTCGCAGCCTGCAATACCTTCTTCTCCGAGGACGAT
GACAAGAGGCTCGACGAGGGCCCTTCCCAAGATCGCCCGGAGGAACCGTACACTGGCCCTCGCACCGTCGATGGT
CGGCCTGCGCCTCAAGCCTACCGACGAAGCCGCAATAACGAGCCGGCGGCAAAGAAGAAGGGTGTCGCCACGCTA
GCCTCTCTCGCATCGGGATCTCAACAAGGTGGCGGTGACGATGACGATGATGACGTGGATGACGACGACCTTGAT
GGCGATACCGAAGACGGCCGCGGGAATCTCTTTGCTGGCGGCGAAAAGTCTGGTCTTGCCGTGCAAGATCCCAAG
CAGGAAGGCGGATCGCGTCAGATTATCAACGACATTCTGGCCAAAGCGAGAGCCAGCAATTCGCGACCAGACGCA
GCCTCCGAAGCTGGTCCCTCGCGATCTTCACTCTTCCGAGGCACGGGCATGACGTTGGGCGGCGAAGGCGTTCAG
AGTCGTGCCGTGCCTGATCCGCTCGGTCCTGTCCGACCCGCCAACGCGCAGCCGCTGGAGCGTGTGCTGCACATC
TGGCAGGACGGATTCAGCATCGATGACGGCGAGCTGCGTCGCTACGATGATCCTGCCAACCGAGCAGACCTGCAG
ATGATACGTTCGGGTCGTGCGCCATTGCACTTGATGAATGTGCAGCACGACCAGCTCGTCGATGTGAAGCTGCAC
CAACACGATACCCCATACTCGCCGCCTCCCAAGCAGTATAAACCCTTTGGGGGAGCCGGACATCGGCTGGGCAGC
CCTGTCCCGGGTGGAGCTTCGGAAGCTCCCGCCACGACGGCCGGCCCATCAACGACGACGAGCACGACGGCAGCC
GCCACAACCTCGAACTCTTCGGAGCCGGCTGTCGACAGTTCGCAGCCTACCGTCATGATCCGCATCCAGCTGCCA
GATGGCACTCGGCTGCCGGCACGCTTCAACACGACTCAAACGCTCGGCGATGTCTACGGCTTCATCCAGGGCGCT
TCCCCGGAGACGCGCACCCGGGCGTGGGTCCTCGTCACAACCTTTCCCAACAAGGAGCACAAAGATAAAGAGCTG
GTCTTGGGCGACATGCCCGAGTTCAAGAGGGGAGGCACGGCGGTTGTTAAGTGGACATAG
Transcript >Ophun1|3799
ATGGCCGAGCAAAACGCCCCAGACCGGGATGAGATGGTCCGCGACTTCTGCGACATGTGCGAAGCCAGCCCTGAG
ATGGCCACGCAGTATCTCGCGGCCCATAACTGGGATTATCTCGCAGCCTGCAATACCTTCTTCTCCGAGGACGAT
GACAAGAGGCTCGACGAGGGCCCTTCCCAAGATCGCCCGGAGGAACCGTACACTGGCCCTCGCACCGTCGATGGT
CGGCCTGCGCCTCAAGCCTACCGACGAAGCCGCAATAACGAGCCGGCGGCAAAGAAGAAGGGTGTCGCCACGCTA
GCCTCTCTCGCATCGGGATCTCAACAAGGTGGCGGTGACGATGACGATGATGACGTGGATGACGACGACCTTGAT
GGCGATACCGAAGACGGCCGCGGGAATCTCTTTGCTGGCGGCGAAAAGTCTGGTCTTGCCGTGCAAGATCCCAAG
CAGGAAGGCGGATCGCGTCAGATTATCAACGACATTCTGGCCAAAGCGAGAGCCAGCAATTCGCGACCAGACGCA
GCCTCCGAAGCTGGTCCCTCGCGATCTTCACTCTTCCGAGGCACGGGCATGACGTTGGGCGGCGAAGGCGTTCAG
AGTCGTGCCGTGCCTGATCCGCTCGGTCCTGTCCGACCCGCCAACGCGCAGCCGCTGGAGCGTGTGCTGCACATC
TGGCAGGACGGATTCAGCATCGATGACGGCGAGCTGCGTCGCTACGATGATCCTGCCAACCGAGCAGACCTGCAG
ATGATACGTTCGGGTCGTGCGCCATTGCACTTGATGAATGTGCAGCACGACCAGCTCGTCGATGTGAAGCTGCAC
CAACACGATACCCCATACTCGCCGCCTCCCAAGCAGTATAAACCCTTTGGGGGAGCCGGACATCGGCTGGGCAGC
CCTGTCCCGGGTGGAGCTTCGGAAGCTCCCGCCACGACGGCCGGCCCATCAACGACGACGAGCACGACGGCAGCC
GCCACAACCTCGAACTCTTCGGAGCCGGCTGTCGACAGTTCGCAGCCTACCGTCATGATCCGCATCCAGCTGCCA
GATGGCACTCGGCTGCCGGCACGCTTCAACACGACTCAAACGCTCGGCGATGTCTACGGCTTCATCCAGGGCGCT
TCCCCGGAGACGCGCACCCGGGCGTGGGTCCTCGTCACAACCTTTCCCAACAAGGAGCACAAAGATAAAGAGCTG
GTCTTGGGCGACATGCCCGAGTTCAAGAGGGGAGGCACGGCGGTTGTTAAGTGGACATAG
Gene >Ophun1|3799
ATGGCCGAGCAAAACGCCCCAGACCGGGATGAGATGGTCCGCGACTTCTGCGACATGTGCGAAGCCAGCCCTGAG
ATGGTACAGCCAGCCTCTATCTCCCAAGTTTCCGAAGCAAGCGCTGACGCAACGCTCACAGGCCACGCAGTATCT
CGCGGCCCATAACTGGGATTATCTCGCAGCCTGCAATACCTTCTTCTCCGAGGACGATGACAAGAGGCTCGACGA
GGGCCCTTCCCAAGATCGCCCGGAGGAACCGTACACTGGCCCTCGCACCGTCGATGGTCGGCCTGCGCCTCAAGC
CTACCGACGAAGCCGCAATAACGAGCCGGCGGCAAAGAAGAAGGGTGTCGCCACGCTAGCCTCTCTCGCATCGGG
ATCTCAACAAGGTGGCGGTGACGATGACGATGATGACGTGGATGACGACGACCTTGATGGCGATACCGAAGACGG
CCGCGGGAATCTCTTTGCTGGCGGCGAAAAGTCTGGTCTTGCCGTGCAAGATCCCAAGCAGGAAGGCGGATCGCG
TCAGATTATCAACGACATTCTGGCCAAAGCGAGAGCGTGCGTATCTGTCCATGACGTCTGACGTCTTCGAGGCCG
TACGCTGATATCGAGGCAGCAGCAATTCGCGACCAGACGCAGCCTCCGAAGCTGGTCCCTCGCGATCTTCACTCT
TCCGAGGCACGGGCATGACGTTGGGCGGCGAAGGCGTTCAGAGTCGTGCCGTGCCTGATCCGCTCGGTCCTGTCC
GACCCGCCAACGCGCAGCCGCTGGAGCGTGTGCTGCACATCTGGCAGGACGGATTCAGCATCGATGACGGCGAGC
TGCGTCGCTACGATGATCCTGCCAACCGAGCAGACCTGCAGATGATACGTTCGGGTCGTGCGCCATTGCACTTGA
TGAATGTGCAGCACGACCAGCTCGTCGATGTGAAGCTGCACCAACACGATACCCCATACTCGCCGCCTCCCAAGC
AGTATAAACCCTTTGGGGGAGCCGGACATCGGCTGGGCAGCCCTGTCCCGGGTGGAGCTTCGGAAGCTCCCGCCA
CGACGGCCGGCCCATCAACGACGACGAGCACGACGGCAGCCGCCACAACCTCGAACTCTTCGGAGCCGGCTGTCG
ACAGTTCGCAGCCTACCGTCATGATCCGCATCCAGCTGCCAGATGGCACTCGGCTGCCGGCACGCTTCAACACGA
CTCAAACGCTCGGCGATGTCTACGGCTTCATCCAGGGCGCTTCCCCGGAGACGCGCACCCGGGCGTGGGTCCTCG
TCACAACCTTTCCCAACAAGGAGCACAAAGATAAAGAGCTGGTCTTGGGCGACATGCCCGAGTTCAAGAGGGGAG
GCACGGCGGTTGTTAAGTGGACATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail