Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3796
Gene name
LocationContig_340:4378..5920
Strand-
Gene length (bp)1542
Transcript length (bp)1542
Coding sequence length (bp)1542
Protein length (aa) 514

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04120 Iron_permease Low affinity iron permease 8.1E-11 185 262
PF04120 Iron_permease Low affinity iron permease 6.8E-19 402 471

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9HFE1|FET4_SCHPO Low-affinity iron/zinc ion transport protein fet4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fet4 PE=2 SV=1 10 491 3.0E-90
sp|P40988|FET4_YEAST Low-affinity Fe(2+) transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET4 PE=1 SV=2 8 490 4.0E-72

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 65 87 22
2 92 114 22
3 195 214 19
4 224 246 22
5 298 320 22
6 335 354 19
7 410 432 22
8 447 464 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3796
MKRNTFTMKRLLALLSSYGAKGPIEHAAPTQHVKDENAASSNVTGYADRDKERALDRWLDRVVKASGSEPVFLFI
VAGLVVWALLGIKYGHTADWAVLISDVQAIVSYIFDSLLMRQQLNEYEKMVRVSASLRSRAISNRRMLRDLLNDP
RRTLQQQQQPFSAADQQLQRLTLSCETLPPETLVDRLSTAASRVVGHLAAVCLYWVCIAVWLGFGPYCDWSNGWQ
LAINSATSALMVFIFAFLANVQERHAAHVERCLHAIFEHDSAVERVLRAMTGDDVENETVVVVAPRMSRIQRAIL
YYADLVGTLTGIAILTAVMVIWLAIGPVMGFSSNWWLLIGTYAGLVGLNDSFVLRNVQMLFHGYAQEALDQVDLE
DKSILDQLRLPDPAATAVPVPSEPLSSRISAWMGIICAHEATVIVGFVFILGLLAGASAMRWSTAGQLLCNIPPS
IIETFFMMILITGHNQAETKRHDRLERFFVRRSVLLSYVRGLEVGDGSGVVDGSLHEVEDVVS*
Coding >Ophun1|3796
ATGAAGCGCAACACCTTCACCATGAAACGCCTCCTGGCATTGCTCTCATCCTACGGAGCAAAAGGACCGATAGAG
CACGCGGCTCCGACGCAACATGTCAAGGATGAGAACGCGGCATCTTCTAATGTGACGGGCTACGCCGACAGAGAC
AAGGAACGCGCGCTGGATCGCTGGCTCGACCGCGTCGTCAAGGCTTCTGGCTCGGAACCCGTTTTCCTCTTCATC
GTCGCTGGCCTCGTCGTCTGGGCCCTTCTCGGCATCAAGTACGGTCATACGGCTGACTGGGCTGTTCTCATATCC
GATGTCCAGGCCATCGTCAGCTACATCTTCGACTCGCTGCTCATGCGGCAGCAGCTCAACGAGTATGAGAAGATG
GTCCGCGTGTCAGCCAGTCTGCGGTCCCGAGCCATCAGCAACAGAAGGATGCTACGCGATTTACTCAACGACCCG
CGCCGTACGTTGCAGCAGCAGCAGCAGCCTTTCTCAGCAGCCGATCAGCAGCTACAACGACTGACGCTCTCGTGC
GAGACGCTGCCTCCCGAGACGCTCGTAGACCGACTGTCTACAGCCGCGTCCCGAGTCGTCGGCCACCTGGCTGCC
GTTTGTCTGTACTGGGTCTGCATCGCCGTCTGGCTTGGCTTCGGCCCCTATTGCGACTGGAGTAACGGGTGGCAG
CTGGCCATTAACTCGGCCACGTCTGCGCTCATGGTCTTCATCTTTGCCTTCCTGGCCAACGTTCAGGAACGACAT
GCAGCTCACGTGGAGCGTTGTCTGCATGCCATCTTTGAGCATGACTCGGCTGTTGAACGGGTCTTGAGGGCCATG
ACGGGTGATGACGTGGAGAATGAGACGGTCGTTGTCGTCGCGCCCCGGATGAGCAGGATTCAGAGGGCCATTCTC
TACTACGCTGATCTAGTCGGAACTCTGACCGGCATCGCCATCCTGACAGCTGTCATGGTCATTTGGTTGGCTATC
GGGCCCGTCATGGGCTTCAGCTCCAACTGGTGGCTCCTCATCGGCACCTACGCTGGCCTCGTCGGCCTCAACGAT
AGCTTCGTCCTTCGAAACGTCCAGATGCTCTTCCACGGCTACGCGCAGGAAGCCCTAGACCAAGTCGACCTCGAA
GACAAGTCCATCCTCGATCAACTCCGACTCCCAGATCCAGCCGCCACCGCCGTCCCCGTCCCGTCCGAGCCGCTC
TCTTCCCGCATCTCAGCCTGGATGGGCATCATCTGCGCGCACGAAGCGACCGTCATCGTTGGCTTCGTCTTCATC
CTCGGTTTGCTGGCTGGTGCTTCGGCTATGAGGTGGTCTACGGCTGGGCAGCTGCTCTGCAATATCCCGCCCAGC
ATCATCGAGACGTTTTTCATGATGATTCTCATTACGGGGCATAATCAGGCCGAGACGAAGAGACATGATCGTTTG
GAGAGGTTCTTTGTGAGGCGATCGGTGCTGCTTTCGTATGTGCGGGGGCTTGAGGTTGGGGATGGATCGGGGGTG
GTGGATGGTTCTTTGCACGAGGTTGAGGATGTTGTTTCGTGA
Transcript >Ophun1|3796
ATGAAGCGCAACACCTTCACCATGAAACGCCTCCTGGCATTGCTCTCATCCTACGGAGCAAAAGGACCGATAGAG
CACGCGGCTCCGACGCAACATGTCAAGGATGAGAACGCGGCATCTTCTAATGTGACGGGCTACGCCGACAGAGAC
AAGGAACGCGCGCTGGATCGCTGGCTCGACCGCGTCGTCAAGGCTTCTGGCTCGGAACCCGTTTTCCTCTTCATC
GTCGCTGGCCTCGTCGTCTGGGCCCTTCTCGGCATCAAGTACGGTCATACGGCTGACTGGGCTGTTCTCATATCC
GATGTCCAGGCCATCGTCAGCTACATCTTCGACTCGCTGCTCATGCGGCAGCAGCTCAACGAGTATGAGAAGATG
GTCCGCGTGTCAGCCAGTCTGCGGTCCCGAGCCATCAGCAACAGAAGGATGCTACGCGATTTACTCAACGACCCG
CGCCGTACGTTGCAGCAGCAGCAGCAGCCTTTCTCAGCAGCCGATCAGCAGCTACAACGACTGACGCTCTCGTGC
GAGACGCTGCCTCCCGAGACGCTCGTAGACCGACTGTCTACAGCCGCGTCCCGAGTCGTCGGCCACCTGGCTGCC
GTTTGTCTGTACTGGGTCTGCATCGCCGTCTGGCTTGGCTTCGGCCCCTATTGCGACTGGAGTAACGGGTGGCAG
CTGGCCATTAACTCGGCCACGTCTGCGCTCATGGTCTTCATCTTTGCCTTCCTGGCCAACGTTCAGGAACGACAT
GCAGCTCACGTGGAGCGTTGTCTGCATGCCATCTTTGAGCATGACTCGGCTGTTGAACGGGTCTTGAGGGCCATG
ACGGGTGATGACGTGGAGAATGAGACGGTCGTTGTCGTCGCGCCCCGGATGAGCAGGATTCAGAGGGCCATTCTC
TACTACGCTGATCTAGTCGGAACTCTGACCGGCATCGCCATCCTGACAGCTGTCATGGTCATTTGGTTGGCTATC
GGGCCCGTCATGGGCTTCAGCTCCAACTGGTGGCTCCTCATCGGCACCTACGCTGGCCTCGTCGGCCTCAACGAT
AGCTTCGTCCTTCGAAACGTCCAGATGCTCTTCCACGGCTACGCGCAGGAAGCCCTAGACCAAGTCGACCTCGAA
GACAAGTCCATCCTCGATCAACTCCGACTCCCAGATCCAGCCGCCACCGCCGTCCCCGTCCCGTCCGAGCCGCTC
TCTTCCCGCATCTCAGCCTGGATGGGCATCATCTGCGCGCACGAAGCGACCGTCATCGTTGGCTTCGTCTTCATC
CTCGGTTTGCTGGCTGGTGCTTCGGCTATGAGGTGGTCTACGGCTGGGCAGCTGCTCTGCAATATCCCGCCCAGC
ATCATCGAGACGTTTTTCATGATGATTCTCATTACGGGGCATAATCAGGCCGAGACGAAGAGACATGATCGTTTG
GAGAGGTTCTTTGTGAGGCGATCGGTGCTGCTTTCGTATGTGCGGGGGCTTGAGGTTGGGGATGGATCGGGGGTG
GTGGATGGTTCTTTGCACGAGGTTGAGGATGTTGTTTCGTGA
Gene >Ophun1|3796
ATGAAGCGCAACACCTTCACCATGAAACGCCTCCTGGCATTGCTCTCATCCTACGGAGCAAAAGGACCGATAGAG
CACGCGGCTCCGACGCAACATGTCAAGGATGAGAACGCGGCATCTTCTAATGTGACGGGCTACGCCGACAGAGAC
AAGGAACGCGCGCTGGATCGCTGGCTCGACCGCGTCGTCAAGGCTTCTGGCTCGGAACCCGTTTTCCTCTTCATC
GTCGCTGGCCTCGTCGTCTGGGCCCTTCTCGGCATCAAGTACGGTCATACGGCTGACTGGGCTGTTCTCATATCC
GATGTCCAGGCCATCGTCAGCTACATCTTCGACTCGCTGCTCATGCGGCAGCAGCTCAACGAGTATGAGAAGATG
GTCCGCGTGTCAGCCAGTCTGCGGTCCCGAGCCATCAGCAACAGAAGGATGCTACGCGATTTACTCAACGACCCG
CGCCGTACGTTGCAGCAGCAGCAGCAGCCTTTCTCAGCAGCCGATCAGCAGCTACAACGACTGACGCTCTCGTGC
GAGACGCTGCCTCCCGAGACGCTCGTAGACCGACTGTCTACAGCCGCGTCCCGAGTCGTCGGCCACCTGGCTGCC
GTTTGTCTGTACTGGGTCTGCATCGCCGTCTGGCTTGGCTTCGGCCCCTATTGCGACTGGAGTAACGGGTGGCAG
CTGGCCATTAACTCGGCCACGTCTGCGCTCATGGTCTTCATCTTTGCCTTCCTGGCCAACGTTCAGGAACGACAT
GCAGCTCACGTGGAGCGTTGTCTGCATGCCATCTTTGAGCATGACTCGGCTGTTGAACGGGTCTTGAGGGCCATG
ACGGGTGATGACGTGGAGAATGAGACGGTCGTTGTCGTCGCGCCCCGGATGAGCAGGATTCAGAGGGCCATTCTC
TACTACGCTGATCTAGTCGGAACTCTGACCGGCATCGCCATCCTGACAGCTGTCATGGTCATTTGGTTGGCTATC
GGGCCCGTCATGGGCTTCAGCTCCAACTGGTGGCTCCTCATCGGCACCTACGCTGGCCTCGTCGGCCTCAACGAT
AGCTTCGTCCTTCGAAACGTCCAGATGCTCTTCCACGGCTACGCGCAGGAAGCCCTAGACCAAGTCGACCTCGAA
GACAAGTCCATCCTCGATCAACTCCGACTCCCAGATCCAGCCGCCACCGCCGTCCCCGTCCCGTCCGAGCCGCTC
TCTTCCCGCATCTCAGCCTGGATGGGCATCATCTGCGCGCACGAAGCGACCGTCATCGTTGGCTTCGTCTTCATC
CTCGGTTTGCTGGCTGGTGCTTCGGCTATGAGGTGGTCTACGGCTGGGCAGCTGCTCTGCAATATCCCGCCCAGC
ATCATCGAGACGTTTTTCATGATGATTCTCATTACGGGGCATAATCAGGCCGAGACGAAGAGACATGATCGTTTG
GAGAGGTTCTTTGTGAGGCGATCGGTGCTGCTTTCGTATGTGCGGGGGCTTGAGGTTGGGGATGGATCGGGGGTG
GTGGATGGTTCTTTGCACGAGGTTGAGGATGTTGTTTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail