Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3794
Gene name
LocationContig_340:461..1492
Strand-
Gene length (bp)1031
Transcript length (bp)966
Coding sequence length (bp)966
Protein length (aa) 322

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04719 TAFII28 hTAFII28-like protein conserved region 8.7E-33 180 284

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US54|TAF11_SCHPO Transcription initiation factor TFIID subunit 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf11 PE=3 SV=1 149 283 3.0E-18
sp|Q5U1X0|TAF11_RAT Transcription initiation factor TFIID subunit 11 OS=Rattus norvegicus GN=Taf11 PE=1 SV=1 172 290 7.0E-17
sp|Q5RA91|TAF11_PONAB Transcription initiation factor TFIID subunit 11 OS=Pongo abelii GN=TAF11 PE=2 SV=1 172 290 7.0E-17
sp|Q15544|TAF11_HUMAN Transcription initiation factor TFIID subunit 11 OS=Homo sapiens GN=TAF11 PE=1 SV=1 172 290 1.0E-16
sp|Q99JX1|TAF11_MOUSE Transcription initiation factor TFIID subunit 11 OS=Mus musculus GN=Taf11 PE=2 SV=1 172 290 8.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US54|TAF11_SCHPO Transcription initiation factor TFIID subunit 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf11 PE=3 SV=1 149 283 3.0E-18
sp|Q5U1X0|TAF11_RAT Transcription initiation factor TFIID subunit 11 OS=Rattus norvegicus GN=Taf11 PE=1 SV=1 172 290 7.0E-17
sp|Q5RA91|TAF11_PONAB Transcription initiation factor TFIID subunit 11 OS=Pongo abelii GN=TAF11 PE=2 SV=1 172 290 7.0E-17
sp|Q15544|TAF11_HUMAN Transcription initiation factor TFIID subunit 11 OS=Homo sapiens GN=TAF11 PE=1 SV=1 172 290 1.0E-16
sp|Q99JX1|TAF11_MOUSE Transcription initiation factor TFIID subunit 11 OS=Mus musculus GN=Taf11 PE=2 SV=1 172 290 8.0E-16
sp|Q54XM9|TAF11_DICDI Transcription initiation factor TFIID subunit 11 OS=Dictyostelium discoideum GN=taf11 PE=3 SV=1 181 289 2.0E-13
sp|A6NLC8|YE016_HUMAN Putative TAF11-like protein ENSP00000332601 OS=Homo sapiens PE=3 SV=2 173 289 6.0E-10
sp|P49906|TAF11_DROME Transcription initiation factor TFIID subunit 11 OS=Drosophila melanogaster GN=Taf11 PE=1 SV=1 180 286 8.0E-10
sp|Q9M565|TAF11_ARATH Transcription initiation factor TFIID subunit 11 OS=Arabidopsis thaliana GN=TAF11 PE=1 SV=1 181 290 6.0E-09
sp|Q04226|TAF11_YEAST Transcription initiation factor TFIID subunit 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF11 PE=1 SV=1 142 251 7.0E-09
sp|F4HR03|TA11B_ARATH Transcription initiation factor TFIID subunit 11b OS=Arabidopsis thaliana GN=TAF11B PE=2 SV=1 181 300 4.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006367 transcription initiation from RNA polymerase II promoter Yes
GO:0005634 nucleus Yes
GO:1901362 organic cyclic compound biosynthetic process No
GO:0032774 RNA biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0006352 DNA-templated transcription, initiation No
GO:0043229 intracellular organelle No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0043227 membrane-bounded organelle No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0043226 organelle No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0018130 heterocycle biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0016070 RNA metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3298
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3090
Ophiocordyceps australis map64 (Brazil) OphauB2|1742
Ophiocordyceps camponoti-floridani Ophcf2|03108
Ophiocordyceps camponoti-rufipedis Ophun1|3794 (this protein)
Ophiocordyceps kimflemingae Ophio5|8105
Ophiocordyceps subramaniannii Hirsu2|6078

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3794
MASPPYLAAALGLSPPNPSPAQLPNKKRSSPLEVGAPPVKRRKPSTLSQASSAGPSHPLRQTSFPPEATSPYAAR
SPSVDAASSAVSGSAVSTHGTKKKRPTARKPKSGRPVATAVHDAGERTPSLVGGKALTTASGPGADNAAAAAADD
DDDEKEELALEDVVARTQEQKQEEIRLRAMLVEAFDADQYNRYEMWRAAKLSDAVVKRVVNATVSQSVPQMVSTA
VKAVAKLFAGEIIEAARNVQGEWVAAGEVQSEMPAPSGGNDEPRRGPLRPDHLREAWRRYKVSGESRGVGVQQLW
HAQHGDGVERFSTRTQKRLFK*
Coding >Ophun1|3794
ATGGCCTCTCCTCCCTACCTCGCCGCCGCGCTCGGCCTGTCTCCTCCCAACCCGTCGCCCGCGCAACTACCCAAC
AAGAAACGGTCTTCGCCCCTGGAAGTCGGCGCACCGCCCGTCAAGCGCCGCAAGCCATCGACCCTCTCGCAGGCA
TCTTCCGCCGGACCCTCGCACCCGCTTCGCCAGACTTCGTTCCCTCCCGAAGCCACATCGCCGTACGCGGCTCGC
TCGCCCTCTGTGGACGCGGCATCGTCGGCCGTCAGCGGCAGCGCCGTCAGCACGCACGGTACCAAGAAGAAACGC
CCGACTGCTCGAAAGCCCAAGTCCGGTCGCCCTGTCGCGACTGCGGTTCATGATGCTGGGGAGCGAACGCCCAGC
CTCGTAGGGGGCAAGGCGCTCACTACTGCCAGCGGACCTGGTGCCGATAACGCCGCCGCAGCCGCTGCGGATGAC
GACGACGACGAGAAGGAAGAGTTGGCGTTGGAGGATGTCGTGGCGCGCACGCAAGAGCAGAAGCAGGAGGAGATT
CGGCTAAGGGCTATGCTCGTTGAGGCTTTTGACGCGGACCAATACAACCGCTACGAGATGTGGCGGGCGGCCAAG
TTATCCGACGCCGTCGTCAAGCGGGTTGTCAACGCTACAGTTTCGCAATCGGTTCCGCAAATGGTCAGCACCGCC
GTCAAAGCCGTGGCCAAGCTCTTTGCCGGCGAGATCATCGAGGCGGCGCGCAACGTGCAGGGCGAGTGGGTAGCC
GCCGGCGAGGTGCAATCCGAGATGCCAGCTCCCAGCGGAGGCAACGACGAGCCGCGACGAGGCCCGCTGAGGCCG
GATCACCTGCGCGAGGCCTGGAGACGGTACAAGGTCAGCGGAGAGAGTCGGGGCGTGGGCGTGCAGCAGCTGTGG
CACGCGCAGCACGGCGATGGCGTCGAGCGATTCTCTACCCGCACACAGAAGCGGCTGTTCAAGTGA
Transcript >Ophun1|3794
ATGGCCTCTCCTCCCTACCTCGCCGCCGCGCTCGGCCTGTCTCCTCCCAACCCGTCGCCCGCGCAACTACCCAAC
AAGAAACGGTCTTCGCCCCTGGAAGTCGGCGCACCGCCCGTCAAGCGCCGCAAGCCATCGACCCTCTCGCAGGCA
TCTTCCGCCGGACCCTCGCACCCGCTTCGCCAGACTTCGTTCCCTCCCGAAGCCACATCGCCGTACGCGGCTCGC
TCGCCCTCTGTGGACGCGGCATCGTCGGCCGTCAGCGGCAGCGCCGTCAGCACGCACGGTACCAAGAAGAAACGC
CCGACTGCTCGAAAGCCCAAGTCCGGTCGCCCTGTCGCGACTGCGGTTCATGATGCTGGGGAGCGAACGCCCAGC
CTCGTAGGGGGCAAGGCGCTCACTACTGCCAGCGGACCTGGTGCCGATAACGCCGCCGCAGCCGCTGCGGATGAC
GACGACGACGAGAAGGAAGAGTTGGCGTTGGAGGATGTCGTGGCGCGCACGCAAGAGCAGAAGCAGGAGGAGATT
CGGCTAAGGGCTATGCTCGTTGAGGCTTTTGACGCGGACCAATACAACCGCTACGAGATGTGGCGGGCGGCCAAG
TTATCCGACGCCGTCGTCAAGCGGGTTGTCAACGCTACAGTTTCGCAATCGGTTCCGCAAATGGTCAGCACCGCC
GTCAAAGCCGTGGCCAAGCTCTTTGCCGGCGAGATCATCGAGGCGGCGCGCAACGTGCAGGGCGAGTGGGTAGCC
GCCGGCGAGGTGCAATCCGAGATGCCAGCTCCCAGCGGAGGCAACGACGAGCCGCGACGAGGCCCGCTGAGGCCG
GATCACCTGCGCGAGGCCTGGAGACGGTACAAGGTCAGCGGAGAGAGTCGGGGCGTGGGCGTGCAGCAGCTGTGG
CACGCGCAGCACGGCGATGGCGTCGAGCGATTCTCTACCCGCACACAGAAGCGGCTGTTCAAGTGA
Gene >Ophun1|3794
ATGGCCTCTCCTCCCTACCTCGCCGCCGCGCTCGGCCTGTCTCCTCCCAACCCGTCGCCCGCGCAACTACCCAAC
AAGAAACGGTCTTCGCCCCTGGAAGTCGGCGCACCGCCCGTCAAGCGCCGCAAGCCATCGACCCTCTCGCAGGCA
TCTTCCGCCGGACCCTCGCACCCGCTTCGCCAGACTTCGTTCCCTCCCGAAGCCACATCGCCGTACGCGGCTCGC
TCGCCCTCTGTGGACGCGGCATCGTCGGCCGTCAGCGGCAGCGCCGTCAGCACGCACGGTACCAAGAAGAAACGC
CCGACTGCTCGAAAGCCCAAGTCCGGTCGCCCTGTCGCGACTGCGGTTCATGATGCTGGGGAGCGAACGCCCAGC
CTCGTAGGGGGCAAGGCGCTCACTACTGCCAGCGGACCTGGTGCCGATAACGCCGCCGCAGCCGCTGCGGATGAC
GACGACGACGAGAAGGAAGAGTTGGCGTTGGAGGATGTCGTGGCGCGCACGCAAGAGCAGAAGCAGGAGGAGATT
CGGCTAAGGGCTATGCTCGTTGAGGCTTTTGACGCGGACCAATACAACCGCTACGAGATGTGGCGGGCGGCCAAG
TTATCCGACGCCGTCGTCAAGCGGGTGCGTCTTTCTCTTTTACATTCTCAATTTTTTACCCTTGTCTTGTTGACT
CAGGCACGCCATAGGTTGTCAACGCTACAGTTTCGCAATCGGTTCCGCAAATGGTCAGCACCGCCGTCAAAGCCG
TGGCCAAGCTCTTTGCCGGCGAGATCATCGAGGCGGCGCGCAACGTGCAGGGCGAGTGGGTAGCCGCCGGCGAGG
TGCAATCCGAGATGCCAGCTCCCAGCGGAGGCAACGACGAGCCGCGACGAGGCCCGCTGAGGCCGGATCACCTGC
GCGAGGCCTGGAGACGGTACAAGGTCAGCGGAGAGAGTCGGGGCGTGGGCGTGCAGCAGCTGTGGCACGCGCAGC
ACGGCGATGGCGTCGAGCGATTCTCTACCCGCACACAGAAGCGGCTGTTCAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail