Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3793
Gene name
LocationContig_34:55469..57648
Strand+
Gene length (bp)2179
Transcript length (bp)1674
Coding sequence length (bp)1674
Protein length (aa) 558

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13092 CENP-L Kinetochore complex Sim4 subunit Fta1 1.1E-42 151 349
PF01212 Beta_elim_lyase Beta-eliminating lyase 9.3E-17 410 539

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O50584|LTAE_PSEUN Low specificity L-threonine aldolase OS=Pseudomonas sp. (strain NCIMB 10558) GN=ltaE PE=1 SV=1 401 556 7.0E-16
sp|Q9HTF1|LTAE_PSEAE Low specificity L-threonine aldolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ltaE PE=3 SV=1 401 556 2.0E-11

GO

GO Term Description Terminal node
GO:0006520 cellular amino acid metabolic process Yes
GO:0016829 lyase activity Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0044281 small molecule metabolic process No
GO:0006082 organic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0043436 oxoacid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3793
MATNGVDAEPAPPFFNTTFSTHSVSPLYIGPEGLPPVRLDLLARRLRDTLVGDVVRGIQVAVEATNTPSGQVGSL
RNVAIRRFELRTILGEGPLVADDAQDESRPGGIWIEISHERAAYAAVLLPGLASSSSRPSTTVQFGRKEADVDAS
QFLHLPLLLLRMPQSLRAVVCEWLSTTFDCRVRKLSLGTRTLVSVMEDWLDVVGLPAKGPDLILSLGFNVPLVEP
ATTEDGEGDTTMMDDDGDAAGLRVLEVTMTSSDVSRFRRYGLAHGAFKSRWETSGDERQRRRLAGGNVDDGWAWR
GASTRQPLMEGLARYLDGHLALDVFHPGVRVVQVSCGSFVLAPSRLKLVKGREEADEASDVGARLKRRTCNVEGL
GLYLRQVGRRRVLRLVLGIIASGFLDDYSEGAHPQVLSALGATNTSQEAGYGADRYSAEARLHLRRHLGHDDAHI
FFVPSGTAANAISIAACLRPHEAVIAATSGHIVTRETGAVEASGHKIITVPPCNGKLTVDGIDKALAENWHFPHM
ARPRLVYVSNATEAGPRTAPSSAKPSSSKTQA*
Coding >Ophun1|3793
ATGGCAACAAACGGCGTCGACGCCGAGCCGGCTCCTCCCTTCTTCAACACGACCTTTTCTACTCACAGCGTGTCG
CCGCTATACATCGGTCCCGAAGGCCTGCCGCCCGTGCGACTCGATCTTCTGGCGAGGCGGCTACGCGATACGCTG
GTCGGGGACGTGGTTCGGGGCATCCAGGTGGCGGTCGAGGCGACGAATACGCCGTCTGGTCAGGTGGGATCCTTG
CGGAATGTTGCTATCCGACGGTTCGAGCTGCGGACCATCTTGGGAGAGGGGCCGTTGGTAGCGGATGACGCGCAA
GATGAGAGCAGACCAGGCGGGATCTGGATCGAAATCAGCCACGAAAGGGCAGCATACGCCGCTGTCCTTTTACCC
GGACTGGCTTCATCGTCTAGCCGACCGTCGACGACGGTGCAATTTGGAAGAAAGGAGGCGGACGTGGACGCCAGT
CAATTCCTGCATCTGCCTCTGCTGCTGCTACGGATGCCGCAGTCGTTACGAGCCGTCGTGTGCGAATGGCTATCG
ACAACGTTTGACTGCCGCGTCAGAAAGCTTTCGCTGGGGACACGAACGCTGGTCAGCGTCATGGAGGACTGGCTA
GACGTGGTCGGTCTACCAGCAAAAGGGCCCGATCTAATTCTCAGCCTCGGCTTCAACGTGCCGCTCGTGGAACCA
GCAACGACGGAAGACGGCGAAGGCGATACGACCATGATGGACGACGACGGCGACGCAGCGGGACTACGCGTGTTG
GAGGTGACGATGACCTCTTCCGACGTCAGCCGATTCCGACGCTACGGACTGGCGCACGGCGCGTTCAAGAGTCGA
TGGGAGACGAGCGGCGATGAGCGGCAACGGCGCAGACTGGCGGGCGGCAACGTCGACGACGGATGGGCGTGGAGG
GGAGCTTCGACGAGGCAGCCGTTGATGGAGGGTCTGGCGCGGTATCTCGACGGGCATCTGGCGCTGGACGTGTTC
CATCCCGGGGTGCGGGTGGTGCAGGTTTCTTGCGGGTCGTTTGTGCTGGCGCCTTCGCGGTTGAAGCTGGTCAAG
GGGAGGGAGGAAGCGGATGAAGCGAGCGATGTCGGCGCGAGGCTTAAGAGAAGGACCTGCAACGTCGAAGGCCTT
GGCTTGTATCTCAGGCAGGTAGGCAGGAGACGGGTTCTGAGACTTGTGCTGGGCATCATTGCATCCGGCTTCCTC
GACGACTACAGCGAAGGCGCCCACCCCCAAGTCCTCTCCGCCCTCGGCGCCACAAACACCAGCCAAGAAGCCGGC
TACGGAGCCGACCGCTACAGCGCCGAAGCCCGCCTGCACCTCCGCCGCCACCTCGGCCACGACGACGCCCACATC
TTCTTCGTCCCCAGCGGAACAGCCGCCAACGCAATCTCCATCGCCGCCTGTCTGCGTCCGCACGAGGCCGTCATC
GCCGCCACCTCGGGCCACATCGTGACGCGCGAGACGGGCGCCGTGGAAGCCAGCGGCCACAAGATCATCACGGTG
CCGCCCTGTAACGGCAAGTTGACGGTCGACGGCATTGACAAGGCCCTGGCGGAGAATTGGCATTTCCCGCACATG
GCTAGGCCGAGGCTCGTCTATGTTTCGAACGCTACAGAGGCGGGACCAAGAACGGCGCCCTCCTCGGCGAAGCCA
TCGTCGTCAAAGACGCAAGCCTAG
Transcript >Ophun1|3793
ATGGCAACAAACGGCGTCGACGCCGAGCCGGCTCCTCCCTTCTTCAACACGACCTTTTCTACTCACAGCGTGTCG
CCGCTATACATCGGTCCCGAAGGCCTGCCGCCCGTGCGACTCGATCTTCTGGCGAGGCGGCTACGCGATACGCTG
GTCGGGGACGTGGTTCGGGGCATCCAGGTGGCGGTCGAGGCGACGAATACGCCGTCTGGTCAGGTGGGATCCTTG
CGGAATGTTGCTATCCGACGGTTCGAGCTGCGGACCATCTTGGGAGAGGGGCCGTTGGTAGCGGATGACGCGCAA
GATGAGAGCAGACCAGGCGGGATCTGGATCGAAATCAGCCACGAAAGGGCAGCATACGCCGCTGTCCTTTTACCC
GGACTGGCTTCATCGTCTAGCCGACCGTCGACGACGGTGCAATTTGGAAGAAAGGAGGCGGACGTGGACGCCAGT
CAATTCCTGCATCTGCCTCTGCTGCTGCTACGGATGCCGCAGTCGTTACGAGCCGTCGTGTGCGAATGGCTATCG
ACAACGTTTGACTGCCGCGTCAGAAAGCTTTCGCTGGGGACACGAACGCTGGTCAGCGTCATGGAGGACTGGCTA
GACGTGGTCGGTCTACCAGCAAAAGGGCCCGATCTAATTCTCAGCCTCGGCTTCAACGTGCCGCTCGTGGAACCA
GCAACGACGGAAGACGGCGAAGGCGATACGACCATGATGGACGACGACGGCGACGCAGCGGGACTACGCGTGTTG
GAGGTGACGATGACCTCTTCCGACGTCAGCCGATTCCGACGCTACGGACTGGCGCACGGCGCGTTCAAGAGTCGA
TGGGAGACGAGCGGCGATGAGCGGCAACGGCGCAGACTGGCGGGCGGCAACGTCGACGACGGATGGGCGTGGAGG
GGAGCTTCGACGAGGCAGCCGTTGATGGAGGGTCTGGCGCGGTATCTCGACGGGCATCTGGCGCTGGACGTGTTC
CATCCCGGGGTGCGGGTGGTGCAGGTTTCTTGCGGGTCGTTTGTGCTGGCGCCTTCGCGGTTGAAGCTGGTCAAG
GGGAGGGAGGAAGCGGATGAAGCGAGCGATGTCGGCGCGAGGCTTAAGAGAAGGACCTGCAACGTCGAAGGCCTT
GGCTTGTATCTCAGGCAGGTAGGCAGGAGACGGGTTCTGAGACTTGTGCTGGGCATCATTGCATCCGGCTTCCTC
GACGACTACAGCGAAGGCGCCCACCCCCAAGTCCTCTCCGCCCTCGGCGCCACAAACACCAGCCAAGAAGCCGGC
TACGGAGCCGACCGCTACAGCGCCGAAGCCCGCCTGCACCTCCGCCGCCACCTCGGCCACGACGACGCCCACATC
TTCTTCGTCCCCAGCGGAACAGCCGCCAACGCAATCTCCATCGCCGCCTGTCTGCGTCCGCACGAGGCCGTCATC
GCCGCCACCTCGGGCCACATCGTGACGCGCGAGACGGGCGCCGTGGAAGCCAGCGGCCACAAGATCATCACGGTG
CCGCCCTGTAACGGCAAGTTGACGGTCGACGGCATTGACAAGGCCCTGGCGGAGAATTGGCATTTCCCGCACATG
GCTAGGCCGAGGCTCGTCTATGTTTCGAACGCTACAGAGGCGGGACCAAGAACGGCGCCCTCCTCGGCGAAGCCA
TCGTCGTCAAAGACGCAAGCCTAG
Gene >Ophun1|3793
ATGGCAACAAACGGCGTCGACGCCGAGCCGGCTCCTCCCTTCTTCAACACGACCTTTTCTACTCACAGCGTGTCG
CCGCTATACATCGGTCCCGAAGGCCTGCCGCCCGTGCGACTCGATCTTCTGGCGAGGCGGCTACGCGATACGCTG
GTCGGGGACGTGGTTCGGGGCATCCAGGTGGCGGTCGAGGCGACGAATACGCCGTCTGGTCAGGTGGGATCCTTG
CGGAATGTTGCTATCCGACGGTTCGAGCTGCGGACCATCTTGGGAGAGGGGCCGTTGGTAGCGGATGACGCGCAA
GATGAGAGCAGACCAGGCGGGATCTGGATCGAAATCAGCCACGAAAGGGCAGCATACGCCGCTGTCCTTTTACCC
GGACTGGCTTCATCGTCTAGCCGACCGTCGACGACGGTGCAATTTGGAAGAAAGGAGGCGGACGTGGACGCCAGT
CAATTCCTGCATCTGCCTCTGCTGCTGCTACGGATGCCGCAGTCGTTACGAGCCGTCGTGTGCGAATGGCTATCG
ACAACGTTTGACTGCCGCGTCAGAAAGCTTTCGCTGGGGACACGAACGCTGGTCAGCGTCATGGAGGACTGGCTA
GACGTGGTCGGTCTACCAGCAAAAGGGCCCGATCTAATTCTCAGCCTCGGCTTCAACGTGCCGCTCGTGGAACCA
GCAACGACGGAAGACGGCGAAGGCGATACGACCATGATGGACGACGACGGCGACGCAGCGGGACTACGCGTGTTG
GAGGTGACGATGACCTCTTCCGACGTCAGCCGATTCCGACGCTACGGACTGGCGCACGGCGCGTTCAAGAGTCGA
TGGGAGACGAGCGGCGATGAGCGGCAACGGCGCAGACTGGCGGGCGGCAACGTCGACGACGGATGGGCGTGGAGG
GGAGCTTCGACGAGGCAGCCGTTGATGGAGGGTCTGGCGCGGTATCTCGACGGGCATCTGGCGCTGGACGTGTTC
CATCCCGGGGTGCGGGTGGTGCAGGTTTCTTGCGGGTCGTTTGTGCTGGCGCCTTCGCGGTTGAAGCTGGTCAAG
GGGAGGGAGGAAGCGGATGAAGGTGTGGCGCGAGCGGCGTGGGCTTTTGTGACGCGGTTGGGAGAGAGGGTGGGA
GAAGAGGCTGTATGAGGATACGAAGGAGTTGACGATGGCATCTCTTGGTTGCAGCGAGGCTGATCAGGGGGTTGA
GAGGGGTTGATGGTGGGCTTGATTGGTGGTTTGCGCCGGCCTTGACCGCCCGGAGCTAGCGAGCGATGTCGGCGC
GAGGCTTAAGAGAAGGACCTGCAACGTCGAAGGCCTTGGCTTGTATCTCAGGCAGGTAGGCAGGAGACGGGTTCT
GAGACTTGTGCTGGGCATCATTGCATCCGGGTGAGTCTCATGGTTTCGAGGCTTCAGTCCCAATGGATCACCGAG
AGCCAGCTGACGGTTCAGGGACCTCGTTCCACCTACATACCAGGTTACTGACTCCCCAACTCCCTCGAGATGCCC
GACATCAGCTCCCCCCCTCGCTACAGCTTCCTCGACGACTACAGCGAAGGCGCCCACCCCCAAGTCCTCTCCGCC
CTCGGCGCCACAAACACCAGCCAAGAAGCCGGCTACGGAGCCGACCGCTACAGCGCCGAAGCCCGCCTGCACCTC
CGCCGCCACCTCGGCCACGACGACGCCCACATCTTCTTCGTCCCCAGCGGAACAGCCGCCAACGCAATCTCCATC
GCCGCCTGTCTGCGTCCGCACGAGGCCGTCATCGCCGCCACCTCGGGCCACATCGTGACGCGCGAGACGGGCGCC
GTGGAAGCCAGCGGCCACAAGATCATCACGGTGCCGCCCTGTAACGGCAAGTTGACGGTCGACGGCATTGACAAG
GCCCTGGCGGAGAATTGGCATTTCCCGCACATGGCTAGGCCGAGGCTCGTCTATGTTTCGAACGCTACAGAGGTT
GGCACTGTTTATTCCAAGGCTGAGCTTGAGGCTATCAGGGATTTGTGTCGGGAGAGGGGACTGCTGCTGTTTATG
GATGGGGCGCGTTTGGGGGCGGCCCTTACGTCGTCCACCGCCCATCTCATGACTCTCCCCGACATCCTCGACCTA
ACCGACATCTTCTGGATAGGCGGGACCAAGAACGGCGCCCTCCTCGGCGAAGCCATCGTCGTCAAAGACGCAAGC
CTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail