Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3792
Gene name
LocationContig_34:53836..54936
Strand+
Gene length (bp)1100
Transcript length (bp)957
Coding sequence length (bp)957
Protein length (aa) 319

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13241 NAD_binding_7 Putative NAD(P)-binding 5.2E-29 77 188
PF14823 Sirohm_synth_C Sirohaem biosynthesis protein C-terminal 4.4E-26 221 288
PF14824 Sirohm_synth_M Sirohaem biosynthesis protein central 2.0E-13 192 217

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14172|MET8_SCHPO Siroheme biosynthesis protein met8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met8 PE=3 SV=1 62 283 4.0E-81
sp|A5CXE4|CYSG_VESOH Siroheme synthase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=cysG PE=3 SV=1 81 254 8.0E-19
sp|Q6LM67|CYSG_PHOPR Siroheme synthase OS=Photobacterium profundum GN=cysG PE=3 SV=1 87 305 4.0E-18
sp|Q1H3L5|CYSG_METFK Siroheme synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=cysG PE=3 SV=2 74 225 1.0E-17
sp|P15807|MET8_YEAST Siroheme biosynthesis protein MET8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET8 PE=1 SV=1 74 262 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14172|MET8_SCHPO Siroheme biosynthesis protein met8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met8 PE=3 SV=1 62 283 4.0E-81
sp|A5CXE4|CYSG_VESOH Siroheme synthase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=cysG PE=3 SV=1 81 254 8.0E-19
sp|Q6LM67|CYSG_PHOPR Siroheme synthase OS=Photobacterium profundum GN=cysG PE=3 SV=1 87 305 4.0E-18
sp|Q1H3L5|CYSG_METFK Siroheme synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=cysG PE=3 SV=2 74 225 1.0E-17
sp|P15807|MET8_YEAST Siroheme biosynthesis protein MET8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET8 PE=1 SV=1 74 262 1.0E-17
sp|Q0VQ05|CYSG_ALCBS Siroheme synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=cysG PE=3 SV=1 75 239 2.0E-17
sp|Q1LTP4|CYSG_BAUCH Siroheme synthase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=cysG PE=3 SV=1 84 307 7.0E-17
sp|B8GUD3|CYSG_THISH Siroheme synthase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=cysG PE=3 SV=1 80 246 1.0E-16
sp|A5WEG6|CYSG_PSYWF Siroheme synthase OS=Psychrobacter sp. (strain PRwf-1) GN=cysG PE=3 SV=1 77 243 1.0E-16
sp|A9LZ77|CYSG_NEIM0 Siroheme synthase OS=Neisseria meningitidis serogroup C (strain 053442) GN=cysG PE=3 SV=1 83 307 2.0E-16
sp|A1AVU5|CYSG_RUTMC Siroheme synthase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=cysG PE=3 SV=1 81 254 3.0E-16
sp|O74468|SUMT_SCHPO Probable uroporphyrinogen-III C-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1739.06c PE=2 SV=1 75 275 4.0E-16
sp|A1WYD5|CYSG2_HALHL Siroheme synthase 2 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=cysG2 PE=3 SV=1 81 280 6.0E-16
sp|A8G9Y3|CYSG1_SERP5 Siroheme synthase 1 OS=Serratia proteamaculans (strain 568) GN=cysG1 PE=3 SV=1 84 305 1.0E-15
sp|B3GZA0|CYSG_ACTP7 Siroheme synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=cysG PE=3 SV=1 81 277 2.0E-15
sp|Q7N8L2|CYSG_PHOLL Siroheme synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysG PE=3 SV=1 80 240 2.0E-15
sp|Q606C9|CYSG_METCA Siroheme synthase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysG PE=3 SV=1 87 254 2.0E-15
sp|A7MJ67|CYSG1_CROS8 Siroheme synthase 1 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysG1 PE=3 SV=1 75 305 2.0E-15
sp|Q5NRM4|CYSG_ZYMMO Siroheme synthase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=cysG PE=3 SV=1 81 254 3.0E-15
sp|Q6CZS0|CYSG2_PECAS Siroheme synthase 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysG2 PE=3 SV=1 80 239 7.0E-15
sp|C1DKY7|CYSG_AZOVD Siroheme synthase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=cysG PE=3 SV=1 75 288 1.0E-14
sp|Q2Y6L7|CYSG_NITMU Siroheme synthase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=cysG PE=3 SV=2 81 258 3.0E-14
sp|Q6D1A4|CYSG1_PECAS Siroheme synthase 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysG1 PE=3 SV=1 84 258 4.0E-14
sp|Q31GG8|CYSG_THICR Siroheme synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=cysG PE=3 SV=1 80 262 5.0E-14
sp|Q3ILQ9|CYSG_PSEHT Siroheme synthase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=cysG PE=3 SV=1 80 279 8.0E-14
sp|A4SHL4|CYSG1_AERS4 Siroheme synthase 1 OS=Aeromonas salmonicida (strain A449) GN=cysG1 PE=3 SV=1 84 254 8.0E-14
sp|C3JY53|CYSG_PSEFS Siroheme synthase OS=Pseudomonas fluorescens (strain SBW25) GN=cysG PE=3 SV=1 75 289 9.0E-14
sp|A0KQJ4|CYSG3_AERHH Siroheme synthase 3 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=cysG3 PE=3 SV=1 84 239 1.0E-13
sp|Q7VQG9|CYSG_BLOFL Siroheme synthase OS=Blochmannia floridanus GN=cysG PE=3 SV=1 81 240 1.0E-13
sp|P57500|CYSG_BUCAI Siroheme synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=cysG PE=3 SV=1 81 240 1.0E-13
sp|Q1IBC9|CYSG_PSEE4 Siroheme synthase OS=Pseudomonas entomophila (strain L48) GN=cysG PE=3 SV=1 75 243 2.0E-13
sp|Q65T49|CYSG_MANSM Siroheme synthase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=cysG PE=3 SV=2 86 240 2.0E-13
sp|Q820Q4|CYSG_NITEU Siroheme synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysG PE=3 SV=2 81 254 3.0E-13
sp|Q2NVN0|CYSG_SODGM Siroheme synthase OS=Sodalis glossinidius (strain morsitans) GN=cysG PE=3 SV=1 84 279 4.0E-13
sp|Q87ZT0|CYSG_PSESM Siroheme synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysG PE=3 SV=1 75 254 5.0E-13
sp|A4TPZ1|CYSG2_YERPP Siroheme synthase 2 OS=Yersinia pestis (strain Pestoides F) GN=cysG2 PE=3 SV=1 84 240 6.0E-13
sp|Q1CLS2|CYSG1_YERPN Siroheme synthase 1 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=cysG1 PE=3 SV=1 84 240 6.0E-13
sp|Q66EC9|CYSG1_YERPS Siroheme synthase 1 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysG1 PE=3 SV=1 84 240 7.0E-13
sp|A7FLY4|CYSG1_YERP3 Siroheme synthase 1 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cysG1 PE=3 SV=1 84 240 7.0E-13
sp|Q48H75|CYSG_PSE14 Siroheme synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=cysG PE=3 SV=1 75 289 1.0E-12
sp|A8AQS4|CYSG_CITK8 Siroheme synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cysG PE=3 SV=1 80 240 1.0E-12
sp|Q0AHC1|CYSG_NITEC Siroheme synthase OS=Nitrosomonas eutropha (strain C91) GN=cysG PE=3 SV=1 81 254 1.0E-12
sp|A0KLD7|CYSG1_AERHH Siroheme synthase 1 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=cysG1 PE=3 SV=1 75 241 2.0E-12
sp|A4XUX3|CYSG_PSEMY Siroheme synthase OS=Pseudomonas mendocina (strain ymp) GN=cysG PE=3 SV=1 75 254 2.0E-12
sp|Q493N1|CYSG_BLOPB Siroheme synthase OS=Blochmannia pennsylvanicus (strain BPEN) GN=cysG PE=3 SV=1 86 273 3.0E-12
sp|Q4ZRL6|CYSG_PSEU2 Siroheme synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=cysG PE=3 SV=1 75 289 3.0E-12
sp|Q4FSU1|CYSG_PSYA2 Siroheme synthase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=cysG PE=3 SV=2 77 243 3.0E-12
sp|A1JSB7|CYSG2_YERE8 Siroheme synthase 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysG2 PE=3 SV=1 80 240 3.0E-12
sp|Q1QAX7|CYSG_PSYCK Siroheme synthase OS=Psychrobacter cryohalolentis (strain K5) GN=cysG PE=3 SV=2 77 243 4.0E-12
sp|A1KU10|CYSG_NEIMF Siroheme synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=cysG PE=3 SV=1 83 307 4.0E-12
sp|B0BTC2|CYSG_ACTPJ Siroheme synthase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=cysG PE=3 SV=1 81 277 5.0E-12
sp|Q3KA85|CYSG_PSEPF Siroheme synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=cysG PE=3 SV=1 75 254 5.0E-12
sp|A0KP37|CYSG2_AERHH Siroheme synthase 2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=cysG2 PE=3 SV=1 80 254 6.0E-12
sp|A1WWP8|CYSG1_HALHL Siroheme synthase 1 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=cysG1 PE=3 SV=1 80 301 8.0E-12
sp|Q4K9V8|CYSG_PSEF5 Siroheme synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=cysG PE=3 SV=1 75 301 8.0E-12
sp|A9HZV6|CYSG_BORPD Siroheme synthase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=cysG PE=3 SV=1 81 225 8.0E-12
sp|P57001|CYSG_NEIMA Siroheme synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysG PE=3 SV=1 83 244 1.0E-11
sp|Q59292|HEMA_CLOJO Probable multifunctional siroheme biosynthesis protein HemA OS=Clostridium josui GN=hemA PE=3 SV=1 73 222 1.0E-11
sp|P95370|CYSG_NEIMB Siroheme synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysG PE=3 SV=3 83 244 2.0E-11
sp|Q15YU1|CYSG_PSEA6 Siroheme synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=cysG PE=3 SV=1 85 255 2.0E-11
sp|A4WFH1|CYSG_ENT38 Siroheme synthase OS=Enterobacter sp. (strain 638) GN=cysG PE=3 SV=1 80 239 2.0E-11
sp|A4SRH0|CYSG2_AERS4 Siroheme synthase 2 OS=Aeromonas salmonicida (strain A449) GN=cysG2 PE=3 SV=2 80 254 2.0E-11
sp|Q664M6|CYSG2_YERPS Siroheme synthase 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysG2 PE=3 SV=1 80 240 2.0E-11
sp|A7FNS9|CYSG2_YERP3 Siroheme synthase 2 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cysG2 PE=3 SV=1 80 240 2.0E-11
sp|A1JJS8|CYSG1_YERE8 Siroheme synthase 1 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysG1 PE=3 SV=1 84 240 3.0E-11
sp|Q3JCS0|CYSG_NITOC Siroheme synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=cysG PE=3 SV=1 81 240 3.0E-11
sp|A4TGU8|CYSG1_YERPP Siroheme synthase 1 OS=Yersinia pestis (strain Pestoides F) GN=cysG1 PE=3 SV=1 80 240 5.0E-11
sp|A6V4H6|CYSG_PSEA7 Siroheme synthase OS=Pseudomonas aeruginosa (strain PA7) GN=cysG PE=3 SV=1 75 254 5.0E-11
sp|Q9I0M7|CYSG_PSEAE Siroheme synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysG PE=3 SV=1 75 254 6.0E-11
sp|Q02NA3|CYSG_PSEAB Siroheme synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=cysG PE=3 SV=1 75 254 7.0E-11
sp|B7UW11|CYSG_PSEA8 Siroheme synthase OS=Pseudomonas aeruginosa (strain LESB58) GN=cysG PE=3 SV=1 75 254 8.0E-11
sp|Q7VZ77|CYSG_BORPE Siroheme synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cysG PE=3 SV=1 83 305 1.0E-10
sp|Q7WB57|CYSG_BORPA Siroheme synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=cysG PE=3 SV=1 83 305 1.0E-10
sp|Q7WMM4|CYSG_BORBR Siroheme synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysG PE=3 SV=1 83 305 1.0E-10
sp|A6TD45|CYSG1_KLEP7 Siroheme synthase 1 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cysG1 PE=3 SV=2 80 258 1.0E-10
sp|A6TF07|CYSG2_KLEP7 Siroheme synthase 2 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cysG2 PE=3 SV=2 80 240 1.0E-10
sp|Q8Z201|CYSG_SALTI Siroheme synthase OS=Salmonella typhi GN=cysG PE=3 SV=1 80 240 1.0E-10
sp|B5BH22|CYSG_SALPK Siroheme synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=cysG PE=3 SV=1 80 240 1.0E-10
sp|Q5PLV8|CYSG_SALPA Siroheme synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cysG PE=3 SV=1 80 240 1.0E-10
sp|A9MME5|CYSG_SALAR Siroheme synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cysG PE=3 SV=1 80 240 2.0E-10
sp|Q0A812|CYSG_ALKEH Siroheme synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=cysG PE=3 SV=1 74 245 3.0E-10
sp|B4TY38|CYSG_SALSV Siroheme synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=cysG PE=3 SV=1 80 240 5.0E-10
sp|B5F8J0|CYSG_SALA4 Siroheme synthase OS=Salmonella agona (strain SL483) GN=cysG PE=3 SV=1 80 240 7.0E-10
sp|P25924|CYSG_SALTY Siroheme synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysG PE=1 SV=1 80 240 7.0E-10
sp|Q74Y23|CYSG_YERPE Siroheme synthase OS=Yersinia pestis GN=cysG PE=3 SV=1 80 240 7.0E-10
sp|Q1C2P9|CYSG_YERPA Siroheme synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=cysG PE=3 SV=1 80 240 7.0E-10
sp|Q1CCP6|CYSG2_YERPN Siroheme synthase 2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=cysG2 PE=3 SV=1 80 240 7.0E-10
sp|C0Q0F3|CYSG_SALPC Siroheme synthase OS=Salmonella paratyphi C (strain RKS4594) GN=cysG PE=3 SV=1 80 240 8.0E-10
sp|A9MT45|CYSG_SALPB Siroheme synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cysG PE=3 SV=1 80 240 8.0E-10
sp|B4SVI1|CYSG_SALNS Siroheme synthase OS=Salmonella newport (strain SL254) GN=cysG PE=3 SV=1 80 240 8.0E-10
sp|B5R2C7|CYSG_SALEP Siroheme synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=cysG PE=3 SV=1 80 240 8.0E-10
sp|Q57IZ5|CYSG_SALCH Siroheme synthase OS=Salmonella choleraesuis (strain SC-B67) GN=cysG PE=3 SV=1 80 240 8.0E-10
sp|B5R7N6|CYSG_SALG2 Siroheme synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=cysG PE=3 SV=1 80 240 8.0E-10
sp|A8GKQ1|CYSG2_SERP5 Siroheme synthase 2 OS=Serratia proteamaculans (strain 568) GN=cysG2 PE=3 SV=1 80 307 1.0E-09
sp|B4TKQ4|CYSG_SALHS Siroheme synthase OS=Salmonella heidelberg (strain SL476) GN=cysG PE=3 SV=1 80 240 1.0E-09
sp|A4VLU6|CYSG_PSEU5 Siroheme synthase OS=Pseudomonas stutzeri (strain A1501) GN=cysG PE=3 SV=2 75 254 1.0E-09
sp|B5FJQ1|CYSG_SALDC Siroheme synthase OS=Salmonella dublin (strain CT_02021853) GN=cysG PE=3 SV=1 80 240 2.0E-09
sp|Q6F8G6|CYSG_ACIAD Siroheme synthase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=cysG PE=3 SV=1 77 239 3.0E-09
sp|A7MKK9|CYSG2_CROS8 Siroheme synthase 2 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysG2 PE=3 SV=1 80 257 3.0E-09
sp|Q3SG32|CYSG_THIDA Siroheme synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=cysG PE=3 SV=1 81 239 4.0E-09
sp|Q2KWB0|CYSG_BORA1 Siroheme synthase OS=Bordetella avium (strain 197N) GN=cysG PE=3 SV=2 81 264 5.0E-09
sp|B7LS75|CYSG_ESCF3 Siroheme synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=cysG PE=3 SV=1 80 240 6.0E-09
sp|Q21K21|CYSG_SACD2 Siroheme synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=cysG PE=3 SV=1 75 241 6.0E-09
sp|Q0TC92|CYSG_ECOL5 Siroheme synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cysG PE=3 SV=1 80 240 6.0E-09
sp|Q1R5R3|CYSG_ECOUT Siroheme synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=cysG PE=3 SV=1 80 240 6.0E-09
sp|A1AGQ2|CYSG_ECOK1 Siroheme synthase OS=Escherichia coli O1:K1 / APEC GN=cysG PE=3 SV=1 80 240 6.0E-09
sp|B7NMD7|CYSG_ECO7I Siroheme synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cysG PE=3 SV=1 80 240 6.0E-09
sp|B7MCY5|CYSG_ECO45 Siroheme synthase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=cysG PE=3 SV=1 80 240 6.0E-09
sp|C4LAG5|CYSG_TOLAT Siroheme synthase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=cysG PE=3 SV=1 80 277 6.0E-09
sp|B7N1F1|CYSG_ECO81 Siroheme synthase OS=Escherichia coli O81 (strain ED1a) GN=cysG PE=3 SV=1 80 240 7.0E-09
sp|Q8FCW8|CYSG_ECOL6 Siroheme synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysG PE=3 SV=1 80 240 7.0E-09
sp|B7UK79|CYSG_ECO27 Siroheme synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cysG PE=3 SV=1 80 240 7.0E-09
sp|Q32AZ8|CYSG_SHIDS Siroheme synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cysG PE=3 SV=1 80 240 7.0E-09
sp|B6I2S7|CYSG_ECOSE Siroheme synthase OS=Escherichia coli (strain SE11) GN=cysG PE=3 SV=1 80 254 7.0E-09
sp|B7M1S1|CYSG_ECO8A Siroheme synthase OS=Escherichia coli O8 (strain IAI1) GN=cysG PE=3 SV=1 80 254 7.0E-09
sp|A7ZSP4|CYSG_ECO24 Siroheme synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cysG PE=3 SV=1 80 254 7.0E-09
sp|B1LHG9|CYSG_ECOSM Siroheme synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cysG PE=3 SV=1 80 240 8.0E-09
sp|P0AEA8|CYSG_ECOLI Siroheme synthase OS=Escherichia coli (strain K12) GN=cysG PE=1 SV=1 80 240 8.0E-09
sp|B1IP96|CYSG_ECOLC Siroheme synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cysG PE=3 SV=1 80 240 8.0E-09
sp|A8A5H5|CYSG_ECOHS Siroheme synthase OS=Escherichia coli O9:H4 (strain HS) GN=cysG PE=3 SV=1 80 240 8.0E-09
sp|B1X716|CYSG_ECODH Siroheme synthase OS=Escherichia coli (strain K12 / DH10B) GN=cysG PE=3 SV=1 80 240 8.0E-09
sp|C4ZUM4|CYSG_ECOBW Siroheme synthase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=cysG PE=3 SV=1 80 240 8.0E-09
sp|P0AEA9|CYSG_ECO57 Siroheme synthase OS=Escherichia coli O157:H7 GN=cysG PE=3 SV=1 80 240 8.0E-09
sp|B7L4P2|CYSG_ECO55 Siroheme synthase OS=Escherichia coli (strain 55989 / EAEC) GN=cysG PE=3 SV=1 80 240 8.0E-09
sp|B7NDX8|CYSG_ECOLU Siroheme synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cysG PE=3 SV=1 80 240 1.0E-08
sp|Q3YWQ3|CYSG_SHISS Siroheme synthase OS=Shigella sonnei (strain Ss046) GN=cysG PE=3 SV=1 80 254 2.0E-08
sp|Q83JB3|CYSG_SHIFL Siroheme synthase OS=Shigella flexneri GN=cysG PE=3 SV=1 80 254 2.0E-08
sp|Q0SZU8|CYSG_SHIF8 Siroheme synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=cysG PE=3 SV=1 80 254 2.0E-08
sp|Q31VS0|CYSG_SHIBS Siroheme synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=cysG PE=3 SV=1 80 240 2.0E-08
sp|B2U3H4|CYSG_SHIB3 Siroheme synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=cysG PE=3 SV=1 80 240 2.0E-08
sp|B5YTS6|CYSG_ECO5E Siroheme synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=cysG PE=3 SV=1 80 240 3.0E-08
sp|C5BGP8|CYSG_EDWI9 Siroheme synthase OS=Edwardsiella ictaluri (strain 93-146) GN=cysG PE=3 SV=1 80 243 4.0E-08
sp|A6VPZ6|CYSG_ACTSZ Siroheme synthase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=cysG PE=3 SV=1 95 239 1.0E-07
sp|A5W1H7|CYSG_PSEP1 Siroheme synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=cysG PE=3 SV=1 136 256 2.0E-07
sp|B1JBD9|CYSG_PSEPW Siroheme synthase OS=Pseudomonas putida (strain W619) GN=cysG PE=3 SV=1 136 256 3.0E-07
sp|Q7NZV7|CYSG_CHRVO Siroheme synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysG PE=3 SV=1 80 225 4.0E-07
sp|Q88FT3|CYSG_PSEPK Siroheme synthase OS=Pseudomonas putida (strain KT2440) GN=cysG PE=3 SV=1 136 256 4.0E-07
sp|A1SRP9|CYSG_PSYIN Siroheme synthase OS=Psychromonas ingrahamii (strain 37) GN=cysG PE=3 SV=1 80 258 5.0E-07
sp|Q5FP95|CYSG_GLUOX Siroheme synthase OS=Gluconobacter oxydans (strain 621H) GN=cysG PE=3 SV=1 70 250 6.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3757
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5520
Ophiocordyceps australis map64 (Brazil) OphauB2|2189
Ophiocordyceps camponoti-floridani Ophcf2|05517
Ophiocordyceps camponoti-rufipedis Ophun1|3792 (this protein)
Ophiocordyceps kimflemingae Ophio5|5027
Ophiocordyceps subramaniannii Hirsu2|7324

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3792
MRFRLCIFLLRATTSSRWILSPAPASSRQRDIRLDSISQVFRLSTHHHSETRLTAAQAQRGMAAKFPAVQPGGSL
ILAWQVQGKNVVVVGGGEVAAGRILNCLNADAVVTVVCPASGLNEEVAFRVAEKEVVHVDRVFEPSDLDGVDMVL
VAIDDPAASTAIWKLCKEKRVPANIADVPPECDFFFGSVHRDGPLQIMVSTNGKGPRLAASIRRFVAKQLPKNAG
NAIETIGTLRAKLRRVAPRAEDSPKRMRWMTKVSDTYEWSEMCTLTEEDMENLLLFYPANKAPPMDILMALRGGN
DVGKLDVFDGSFGFSVGA*
Coding >Ophun1|3792
ATGCGCTTTAGGCTGTGTATCTTTCTACTGCGCGCGACCACTTCCTCTCGGTGGATCCTTTCCCCGGCGCCGGCC
TCATCACGTCAACGAGACATCAGGCTTGACTCCATTTCGCAGGTGTTCAGGCTCTCGACTCACCACCACTCCGAG
ACCCGTCTCACCGCTGCTCAAGCCCAAAGAGGCATGGCAGCCAAGTTCCCAGCAGTCCAACCCGGCGGCAGCCTG
ATTCTCGCCTGGCAAGTCCAGGGCAAAAACGTTGTCGTCGTCGGCGGAGGCGAGGTTGCTGCCGGTCGCATCCTC
AACTGCCTCAACGCCGATGCCGTCGTCACCGTCGTCTGTCCGGCTTCCGGGCTGAACGAAGAGGTAGCCTTTCGG
GTCGCGGAGAAGGAGGTTGTACACGTTGATCGCGTGTTTGAGCCGAGTGATCTCGACGGCGTTGACATGGTGCTG
GTCGCCATTGACGATCCTGCCGCTTCGACGGCCATCTGGAAGCTCTGCAAGGAGAAGAGGGTGCCAGCCAACATC
GCCGACGTGCCTCCGGAATGCGATTTCTTCTTTGGGAGTGTGCACCGCGACGGACCGCTGCAAATCATGGTCAGC
ACCAATGGCAAGGGTCCGAGGCTGGCGGCTTCGATCCGCCGCTTCGTTGCCAAGCAGCTGCCCAAGAATGCGGGC
AATGCCATCGAGACCATCGGGACGCTGAGGGCTAAGCTGCGCCGCGTCGCGCCTAGGGCCGAGGATAGTCCCAAA
CGGATGCGGTGGATGACCAAGGTCAGCGATACGTACGAGTGGTCTGAGATGTGTACCCTCACCGAGGAGGATATG
GAGAACTTGTTGCTCTTCTATCCGGCTAACAAGGCGCCGCCGATGGATATTCTGATGGCGCTGCGGGGGGGGAAT
GACGTGGGGAAGCTCGATGTCTTTGACGGGTCTTTTGGGTTCAGCGTTGGAGCATGA
Transcript >Ophun1|3792
ATGCGCTTTAGGCTGTGTATCTTTCTACTGCGCGCGACCACTTCCTCTCGGTGGATCCTTTCCCCGGCGCCGGCC
TCATCACGTCAACGAGACATCAGGCTTGACTCCATTTCGCAGGTGTTCAGGCTCTCGACTCACCACCACTCCGAG
ACCCGTCTCACCGCTGCTCAAGCCCAAAGAGGCATGGCAGCCAAGTTCCCAGCAGTCCAACCCGGCGGCAGCCTG
ATTCTCGCCTGGCAAGTCCAGGGCAAAAACGTTGTCGTCGTCGGCGGAGGCGAGGTTGCTGCCGGTCGCATCCTC
AACTGCCTCAACGCCGATGCCGTCGTCACCGTCGTCTGTCCGGCTTCCGGGCTGAACGAAGAGGTAGCCTTTCGG
GTCGCGGAGAAGGAGGTTGTACACGTTGATCGCGTGTTTGAGCCGAGTGATCTCGACGGCGTTGACATGGTGCTG
GTCGCCATTGACGATCCTGCCGCTTCGACGGCCATCTGGAAGCTCTGCAAGGAGAAGAGGGTGCCAGCCAACATC
GCCGACGTGCCTCCGGAATGCGATTTCTTCTTTGGGAGTGTGCACCGCGACGGACCGCTGCAAATCATGGTCAGC
ACCAATGGCAAGGGTCCGAGGCTGGCGGCTTCGATCCGCCGCTTCGTTGCCAAGCAGCTGCCCAAGAATGCGGGC
AATGCCATCGAGACCATCGGGACGCTGAGGGCTAAGCTGCGCCGCGTCGCGCCTAGGGCCGAGGATAGTCCCAAA
CGGATGCGGTGGATGACCAAGGTCAGCGATACGTACGAGTGGTCTGAGATGTGTACCCTCACCGAGGAGGATATG
GAGAACTTGTTGCTCTTCTATCCGGCTAACAAGGCGCCGCCGATGGATATTCTGATGGCGCTGCGGGGGGGGAAT
GACGTGGGGAAGCTCGATGTCTTTGACGGGTCTTTTGGGTTCAGCGTTGGAGCATGA
Gene >Ophun1|3792
ATGCGCTTTAGGCTGTGTATCTTTCTACTGCGCGCGACCACTTCCTCTCGGTGGATCCTTTCCCCGGCGCCGGCC
TCATCACGTCAACGAGACATCAGGCTTGACTCCATTTCGCAGGTGTTCAGGCTCTCGACTCACCACCACTCCGAG
ACCCGTCTCACCGCTGCTCAAGCCCAAAGAGGCATGGCAGCCAAGTTCCCAGCAGTCCAACCCGGCGGCAGCCTG
ATTCTCGCCTGGCAAGTCCAGGGCAAAAACGTTGTCGTCGTCGGCGGAGGCGAGGTTCGCAACCCTTTTCCCCTT
GAGTCTCTTTTGTACAACATGCAGCTCCGCAACTCTTCTCACGCGCGCTGAAACGAAAAGGTTCGCCGTAGGTTG
CTGCCGGTCGCATCCTCAACTGCCTCAACGCCGATGCCGTCGTCACCGTCGTCTGTCCGGCTTCCGGGCTGAACG
AAGAGGTAGCCTTTCGGGTCGCGGAGAAGGAGGTTGTACACGTTGATCGCGTGTTTGAGCCGAGTGATCTCGACG
GCGTTGACATGGTGCTGGTCGCCATTGACGATCCTGCCGCTTCGACGGCCATCTGGAAGCTCTGCAAGGAGAAGA
GGGTGCCAGCCAACATCGCCGACGTGCCTCCGGAATGCGATTTCTTCTTTGGGAGTGTGCACCGCGACGGACCGC
TGCAAATCATGGTCAGCACCAATGGCAAGGGTCCGAGGCTGGCGGCTTCGATCCGCCGCTTCGTTGCCAAGCAGC
TGCCCAAGAATGCGGGCAATGCCATCGAGACCATCGGGACGCTGAGGGCTAAGCTGCGCCGCGTCGCGCCTAGGG
CCGAGGATAGTCCCAAACGGATGCGGTGGTGGGTGGTGTCTGGTGCTGGCTGTCTGCGTGTCTCGCTTACATGGC
TTAGGATGACCAAGGTCAGCGATACGTACGAGTGGTCTGAGATGTGTACCCTCACCGAGGAGGATATGGAGAACT
TGTTGCTCTTCTATCCGGCTAACAAGGCGCCGCCGATGGATATTCTGATGGCGCTGCGGGGGGGGAATGACGTGG
GGAAGCTCGATGTCTTTGACGGGTCTTTTGGGTTCAGCGTTGGAGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail