Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3791
Gene name
LocationContig_34:51434..53637
Strand-
Gene length (bp)2203
Transcript length (bp)1731
Coding sequence length (bp)1731
Protein length (aa) 577

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01363 FYVE FYVE zinc finger 8.6E-18 291 371
PF11464 Rbsn Rabenosyn Rab binding domain 1.5E-13 517 555

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P32609|PEP7_YEAST Vacuolar segregation protein PEP7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP7 PE=1 SV=2 79 558 4.0E-55
sp|O13786|PEP7_SCHPO Vacuolar segregation protein pep7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pep7 PE=3 SV=1 16 565 1.0E-51
sp|Q9H1K0|RBNS5_HUMAN Rabenosyn-5 OS=Homo sapiens GN=RBSN PE=1 SV=2 219 545 4.0E-12
sp|Q80Y56|RBNS5_MOUSE Rabenosyn-5 OS=Mus musculus GN=Rbsn PE=1 SV=1 219 536 2.0E-10

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup960
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5519
Ophiocordyceps australis map64 (Brazil) OphauB2|2188
Ophiocordyceps camponoti-floridani Ophcf2|05518
Ophiocordyceps camponoti-rufipedis Ophun1|3791 (this protein)
Ophiocordyceps kimflemingae Ophio5|5028
Ophiocordyceps subramaniannii Hirsu2|7325
Ophiocordyceps subramaniannii Hirsu2|7326

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3791
MSARTLGGGRILGSGRGLAPPTPPRVSSRSGSPFAPSESSASMTLLQLNRHIDDNHQELPEQEQDEVKTWFDKQV
LKAKRFQPLTLINQKLRGLDVFESNESNPLPHTTATLSTPSNGKQPATVPIDPDDLITRNHWQRSTAHDVCTDPT
CGRGLGPLNGSINCRKCGRLFCEEHTMYQMKLSRSANHEPVRGYWARVCETCYKSREGYNDHVGLEVDHTGFFVG
ARCKRLERQKLETARLEKRLTKLTRLLAEMPEGNAVVQGGGSLLSPVSSLIGHKDPRKLLEQSVVPWEDDDAVSK
CPFCQQEFGSWTFRRHHCRICGRVVCADVQTGCSSEVGLNIRSAMTTPYSEKSAPQLQAEIRMCRDCKQTIFSHR
DFTTSLEHKPPDQKAYETLRQFERGILLLLPSFHRSLVALQPPGSGGSDASSSWSSSATQTGAATPTQAQIHEAA
KIRKRLMDSFAKYGAAAKRLRALKAESRTQARLQEAVYSYASSFLHTNMLPLKSLPQRDAKQRLAILREQRQMVE
DMVGKATAARRFDEVAALARNRDELDVEIEGVERLVSEVDGRWEGVYANGA*
Coding >Ophun1|3791
ATGTCGGCCCGGACGCTGGGAGGCGGCCGTATCCTCGGCAGCGGGAGGGGCCTCGCGCCGCCGACGCCCCCGCGA
GTGTCGTCCCGGTCTGGCAGCCCGTTTGCGCCATCGGAGAGTTCGGCGTCGATGACGCTTCTTCAGCTCAATCGA
CACATCGACGATAACCACCAGGAACTCCCCGAGCAGGAACAGGACGAGGTCAAGACTTGGTTCGACAAACAGGTC
CTCAAAGCCAAACGCTTCCAACCCTTGACACTCATCAACCAGAAACTCCGAGGCCTCGACGTCTTCGAATCCAAC
GAGTCAAACCCGCTCCCTCACACGACAGCAACACTATCAACACCATCCAACGGCAAGCAACCCGCCACCGTCCCC
ATCGACCCAGACGACCTTATCACCCGAAACCACTGGCAACGCTCAACAGCCCACGACGTCTGCACGGATCCCACC
TGCGGACGCGGCCTCGGCCCATTAAACGGCAGCATCAACTGCCGCAAATGCGGCCGCCTCTTCTGCGAGGAGCAC
ACCATGTACCAGATGAAGCTCAGCCGGAGCGCCAACCACGAACCCGTCCGCGGCTACTGGGCCCGCGTGTGCGAA
ACGTGCTACAAGTCGCGCGAAGGGTACAACGACCACGTCGGTCTCGAGGTCGATCATACGGGCTTCTTCGTCGGC
GCGCGCTGCAAAAGGCTAGAGCGGCAGAAGCTGGAGACGGCCAGGCTGGAGAAGAGGCTTACCAAGTTGACGCGC
TTGCTGGCTGAGATGCCCGAGGGCAACGCCGTTGTGCAGGGAGGGGGCTCGCTTCTCAGTCCCGTCTCGTCGCTT
ATCGGTCATAAGGATCCGCGTAAGTTGCTGGAGCAGTCTGTTGTGCCGTGGGAGGACGACGACGCTGTGTCCAAG
TGTCCGTTTTGTCAGCAAGAGTTTGGAAGCTGGACTTTTAGAAGGCATCACTGTCGGATATGCGGTCGAGTTGTC
TGCGCCGATGTTCAAACGGGCTGCTCTTCCGAAGTCGGCCTCAACATCCGCAGCGCCATGACAACCCCCTACTCC
GAAAAGAGCGCCCCCCAACTCCAAGCCGAAATCCGCATGTGCCGCGACTGCAAGCAAACCATCTTCTCCCACCGC
GACTTCACCACCTCCCTCGAGCACAAACCCCCCGACCAAAAAGCCTACGAGACCCTCCGCCAATTCGAGCGCGGC
ATCCTCCTCCTCCTCCCTTCCTTTCACCGCTCCCTCGTCGCTCTTCAACCGCCGGGGAGTGGTGGCTCGGATGCT
TCGTCGTCGTGGTCCTCTTCCGCGACGCAGACGGGAGCGGCAACGCCTACGCAGGCACAGATCCATGAGGCGGCC
AAGATTCGGAAGCGGTTGATGGATAGCTTTGCAAAGTATGGCGCGGCGGCGAAGCGGCTTCGTGCCTTAAAGGCC
GAGTCTAGGACGCAGGCTCGCCTACAGGAAGCCGTCTATTCCTACGCAAGTTCCTTCTTGCACACAAACATGCTC
CCGCTCAAGAGCCTCCCCCAGCGCGACGCCAAGCAACGGCTCGCCATCCTCCGCGAGCAACGCCAGATGGTCGAG
GACATGGTCGGCAAGGCCACCGCCGCCAGACGCTTCGACGAGGTGGCCGCCCTGGCGAGGAACAGGGATGAGCTG
GACGTTGAGATTGAGGGGGTGGAGCGGCTGGTTAGCGAGGTGGATGGGCGGTGGGAGGGGGTTTATGCTAATGGT
GCGTGA
Transcript >Ophun1|3791
ATGTCGGCCCGGACGCTGGGAGGCGGCCGTATCCTCGGCAGCGGGAGGGGCCTCGCGCCGCCGACGCCCCCGCGA
GTGTCGTCCCGGTCTGGCAGCCCGTTTGCGCCATCGGAGAGTTCGGCGTCGATGACGCTTCTTCAGCTCAATCGA
CACATCGACGATAACCACCAGGAACTCCCCGAGCAGGAACAGGACGAGGTCAAGACTTGGTTCGACAAACAGGTC
CTCAAAGCCAAACGCTTCCAACCCTTGACACTCATCAACCAGAAACTCCGAGGCCTCGACGTCTTCGAATCCAAC
GAGTCAAACCCGCTCCCTCACACGACAGCAACACTATCAACACCATCCAACGGCAAGCAACCCGCCACCGTCCCC
ATCGACCCAGACGACCTTATCACCCGAAACCACTGGCAACGCTCAACAGCCCACGACGTCTGCACGGATCCCACC
TGCGGACGCGGCCTCGGCCCATTAAACGGCAGCATCAACTGCCGCAAATGCGGCCGCCTCTTCTGCGAGGAGCAC
ACCATGTACCAGATGAAGCTCAGCCGGAGCGCCAACCACGAACCCGTCCGCGGCTACTGGGCCCGCGTGTGCGAA
ACGTGCTACAAGTCGCGCGAAGGGTACAACGACCACGTCGGTCTCGAGGTCGATCATACGGGCTTCTTCGTCGGC
GCGCGCTGCAAAAGGCTAGAGCGGCAGAAGCTGGAGACGGCCAGGCTGGAGAAGAGGCTTACCAAGTTGACGCGC
TTGCTGGCTGAGATGCCCGAGGGCAACGCCGTTGTGCAGGGAGGGGGCTCGCTTCTCAGTCCCGTCTCGTCGCTT
ATCGGTCATAAGGATCCGCGTAAGTTGCTGGAGCAGTCTGTTGTGCCGTGGGAGGACGACGACGCTGTGTCCAAG
TGTCCGTTTTGTCAGCAAGAGTTTGGAAGCTGGACTTTTAGAAGGCATCACTGTCGGATATGCGGTCGAGTTGTC
TGCGCCGATGTTCAAACGGGCTGCTCTTCCGAAGTCGGCCTCAACATCCGCAGCGCCATGACAACCCCCTACTCC
GAAAAGAGCGCCCCCCAACTCCAAGCCGAAATCCGCATGTGCCGCGACTGCAAGCAAACCATCTTCTCCCACCGC
GACTTCACCACCTCCCTCGAGCACAAACCCCCCGACCAAAAAGCCTACGAGACCCTCCGCCAATTCGAGCGCGGC
ATCCTCCTCCTCCTCCCTTCCTTTCACCGCTCCCTCGTCGCTCTTCAACCGCCGGGGAGTGGTGGCTCGGATGCT
TCGTCGTCGTGGTCCTCTTCCGCGACGCAGACGGGAGCGGCAACGCCTACGCAGGCACAGATCCATGAGGCGGCC
AAGATTCGGAAGCGGTTGATGGATAGCTTTGCAAAGTATGGCGCGGCGGCGAAGCGGCTTCGTGCCTTAAAGGCC
GAGTCTAGGACGCAGGCTCGCCTACAGGAAGCCGTCTATTCCTACGCAAGTTCCTTCTTGCACACAAACATGCTC
CCGCTCAAGAGCCTCCCCCAGCGCGACGCCAAGCAACGGCTCGCCATCCTCCGCGAGCAACGCCAGATGGTCGAG
GACATGGTCGGCAAGGCCACCGCCGCCAGACGCTTCGACGAGGTGGCCGCCCTGGCGAGGAACAGGGATGAGCTG
GACGTTGAGATTGAGGGGGTGGAGCGGCTGGTTAGCGAGGTGGATGGGCGGTGGGAGGGGGTTTATGCTAATGGT
GCGTGA
Gene >Ophun1|3791
ATGTCGGCCCGGACGCTGGGAGGCGGCCGTATCCTCGGCAGCGGGAGGGGCCTCGCGCCGCCGACGCCCCCGCGA
GTGTCGTCCCGGTCTGGCAGCCCGTTTGCGCCATCGGAGAGTTCGGCGTCGGTTGGGTCTGTTTCGCTTTCGCCG
CCGGCGTCGGGGGGGTTGCCTGATCTTGGTCATGATATTGGGTCGAGGATTAGTGTTGGGGCTCAGGCTGGGGGG
AGGGCTGGTGGTGATGGGACGGGATTGGTGTGTCCGATATGCAGTGAGGAGATGGTGGGTTGAGTCTGGGGTTGT
TGTTTGTGATTGTGATGTTTGGCTGACGGGTTACTCCAGATGACGCTTCTTCAGCTCAATCGACACATCGACGAT
AACCACCAGGAACTCCCCGAGCAGGAACAGGACGAGGTCAAGACTTGGTTCGACAAACAGGTCCTCAAAGCCAAA
CGCTTCCAACCCTTGACACTCATCAACCAGAAACTCCGAGGCCTCGACGTCTTCGAATCCAACGAGTCAAACCCG
CTCCCTCACACGACAGCAACACTATCAACACCATCCAACGGCAAGCAACCCGCCACCGTCCCCATCGACCCAGAC
GACCTTATCACCCGAAACCACTGGCAACGCTCAACAGCCCACGACGTCTGCACGGATCCCACCTGCGGACGCGGC
CTCGGCCCATTAAACGGCAGCATCAACTGCCGCAAATGCGGCCGCCTCTTCTGCGAGGAGCACACCATGTACCAG
ATGAAGCTCAGCCGGAGCGCCAACCACGAACCCGTCCGCGGCTACTGGGCCCGCGTGTGCGAAACGTGCTACAAG
TCGCGCGAAGGGTACAACGACCACGTCGGTCTCGAGGTCGATCATACGGGCTTCTTCGTCGGCGCGCGCTGCAAA
AGGCTAGAGCGGCAGAAGCTGGAGACGGCCAGGCTGGAGAAGAGGCTTACCAAGTTGACGCGCTTGCTGGCTGAG
ATGCCCGAGGGCAACGCCGTTGTGCAGGGAGGGGGCTCGCTTCTCAGTCCCGTCTCGTCGCTTATCGGTCATAAG
GATCCGCGTAAGTTGCTGGAGCAGTCTGTTGTGCCGTGGGAGGACGACGACGCTGTGTCCAAGTGTCCGTTTTGT
CAGCAAGAGTTTGGAAGCTGGACTTTTAGAAGGCATCACTGTCGGATATGCGGTCGAGTTGTCTGCGCCGATGTT
CAAACGGGCTGCTCTTCCGAAGTCGGCCTCAACATCCGCAGCGGTGTGTTCAAACAACCCCTTATCATCCCCTCA
ACCCTCAACTAACCACCTCCCCCCCCCAGCCATGACAACCCCCTACTCCGAAAAGAGCGCCCCCCAACTCCAAGC
CGAAATCCGCATGTGCCGCGACTGCAAGCAAACCATCTTCTCCCACCGCGACTTCACCACCTCCCTCGAGCACAA
ACCCCCCGACCAAAAAGCCTACGAGACCCTCCGCCAATTCGAGCGCGGCATCCTCCTCCTCCTCCCTTCCTTTCA
CCGCTCCCTCGTCGCTCTTCAACCGCCGGGGAGTGGTGGCTCGGATGCTTCGTCGTCGTGGTCCTCTTCCGCGAC
GCAGACGGGAGCGGCAACGCCTACGCAGGCACAGATCCATGAGGCGGCCAAGATTCGGAAGCGGTTGATGGATAG
CTTTGCAAAGTATGGCGCGGCGGCGAAGCGGCTTCGTGCCTTAAAGGCCGAGTCTAGGACGCAGGCTCGCCTACA
GGAAGCCGTCTATTCCTACGCAAGTTCCTTCTTGCACACAAACATGCTCCCGCTCAAGAGCCTCCCCCGTCTCCT
CCGCGACTCCTCAACCCCCCATCACAACCACCATCACCATCCTCCCCTCCCTCCCCGATCAACACACCCCCCCCA
ATCCTCCAGCCTCCGCCACACCCAACTCGCCACCCCCCCGGAACCCAGCTCAGCAAGCACAACAACCACCCTGAC
AACCACAACCACAACCGCAACAACGCTGCTGGAGGACCAAGAGCGCGACGCCAAGCAACGGCTCGCCATCCTCCG
CGAGCAACGCCAGATGGTCGAGGACATGGTCGGCAAGGCCACCGCCGCCAGACGCTTCGACGAGGTGGCCGCCCT
GGCGAGGAACAGGGATGAGCTGGACGTTGAGATTGAGGGGGTGGAGCGGCTGGTTAGCGAGGTGGATGGGCGGTG
GGAGGGGGTTTATGCTAATGGTGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail