Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3788
Gene name
LocationContig_34:46036..46638
Strand+
Gene length (bp)602
Transcript length (bp)549
Coding sequence length (bp)549
Protein length (aa) 183

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 1.2E-15 67 157
PF08445 FR47 FR47-like protein 5.9E-08 100 160
PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain 3.0E-07 81 157
PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain 6.1E-06 81 159

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P79081|ATS1_SCHPO N-acetyltransferase ats1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ats1 PE=2 SV=1 6 181 8.0E-40
sp|Q9ZV06|NATAL_ARATH Probable acetyltransferase NATA1-like OS=Arabidopsis thaliana GN=At2g39020 PE=2 SV=1 8 177 1.0E-25
sp|Q7PCJ8|SAT2_BOVIN Diamine acetyltransferase 2 OS=Bos taurus GN=SAT2 PE=2 SV=1 6 179 3.0E-23
sp|Q9ZV05|NATA1_ARATH L-ornithine N5-acetyltransferase NATA1 OS=Arabidopsis thaliana GN=NATA1 PE=2 SV=1 8 180 2.0E-22
sp|Q7PCJ9|SAT2_PIG Diamine acetyltransferase 2 OS=Sus scrofa GN=SAT2 PE=2 SV=1 1 179 7.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P79081|ATS1_SCHPO N-acetyltransferase ats1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ats1 PE=2 SV=1 6 181 8.0E-40
sp|Q9ZV06|NATAL_ARATH Probable acetyltransferase NATA1-like OS=Arabidopsis thaliana GN=At2g39020 PE=2 SV=1 8 177 1.0E-25
sp|Q7PCJ8|SAT2_BOVIN Diamine acetyltransferase 2 OS=Bos taurus GN=SAT2 PE=2 SV=1 6 179 3.0E-23
sp|Q9ZV05|NATA1_ARATH L-ornithine N5-acetyltransferase NATA1 OS=Arabidopsis thaliana GN=NATA1 PE=2 SV=1 8 180 2.0E-22
sp|Q7PCJ9|SAT2_PIG Diamine acetyltransferase 2 OS=Sus scrofa GN=SAT2 PE=2 SV=1 1 179 7.0E-22
sp|Q6P8J2|SAT2_MOUSE Diamine acetyltransferase 2 OS=Mus musculus GN=Sat2 PE=1 SV=1 1 179 2.0E-19
sp|Q96F10|SAT2_HUMAN Diamine acetyltransferase 2 OS=Homo sapiens GN=SAT2 PE=1 SV=1 1 179 5.0E-19
sp|Q3T0Q0|SAT1_BOVIN Diamine acetyltransferase 1 OS=Bos taurus GN=SAT1 PE=2 SV=1 4 179 6.0E-17
sp|Q28999|SAT1_PIG Diamine acetyltransferase 1 OS=Sus scrofa GN=SAT1 PE=2 SV=1 4 179 1.0E-16
sp|P48026|SAT1_MOUSE Diamine acetyltransferase 1 OS=Mus musculus GN=Sat1 PE=1 SV=1 4 179 2.0E-16
sp|Q9JHW6|SAT1_CRIGR Diamine acetyltransferase 1 OS=Cricetulus griseus GN=SAT1 PE=2 SV=1 4 179 4.0E-16
sp|P49431|SAT1_MUSSA Diamine acetyltransferase 1 OS=Mus saxicola GN=Sat1 PE=3 SV=1 4 179 5.0E-16
sp|P21673|SAT1_HUMAN Diamine acetyltransferase 1 OS=Homo sapiens GN=SAT1 PE=1 SV=1 4 179 9.0E-16
sp|Q8AXL1|SAT1_CHICK Diamine acetyltransferase 1 OS=Gallus gallus GN=SAT1 PE=2 SV=1 1 179 1.0E-15
sp|Q01612|SAT1_MESAU Diamine acetyltransferase 1 OS=Mesocricetus auratus GN=SAT1 PE=2 SV=1 4 179 3.0E-15
sp|Q86VE3|SATL1_HUMAN Spermidine/spermine N(1)-acetyltransferase-like protein 1 OS=Homo sapiens GN=SATL1 PE=2 SV=3 8 158 4.0E-13
sp|Q9SMB8|THT11_TOBAC Tyramine N-feruloyltransferase 4/11 OS=Nicotiana tabacum GN=THT4 PE=2 SV=1 6 178 7.0E-10
sp|P80969|THT10_TOBAC Tyramine N-feruloyltransferase 10/30 OS=Nicotiana tabacum GN=THT10 PE=1 SV=2 6 178 1.0E-09
sp|Q9D5N8|SATL1_MOUSE Spermidine/spermine N(1)-acetyltransferase-like protein 1 OS=Mus musculus GN=Satl1 PE=2 SV=2 8 162 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Yes
GO:0008080 N-acetyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016410 N-acyltransferase activity No
GO:0016407 acetyltransferase activity No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016746 acyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3788
MASSDVTVRHACRQDVPAILDLIKGLAEYENEPNAVEATVESLSSTLAFAPSPDRASVADTEPTSPSRPARCLLL
LPPGGDKPVGMALYFYNYSTWRSRPGIYLEDLFVQPSHRAKGYGKRLLVELAREVVALDGRRLEWSVLKWNEPSI
KFYESIGAKPMSEWVGMRVDGPALDKLASLLD*
Coding >Ophun1|3788
ATGGCATCTTCCGACGTCACGGTGCGACACGCCTGCCGCCAGGACGTTCCCGCCATCCTCGACCTGATCAAGGGC
CTGGCCGAGTACGAAAACGAGCCCAACGCCGTCGAGGCCACCGTCGAGTCCCTGAGCAGCACCCTCGCCTTCGCC
CCCTCTCCCGATCGGGCATCCGTCGCCGACACGGAGCCGACTTCGCCCTCGCGGCCCGCCCGTTGCCTGCTGCTG
CTGCCGCCCGGTGGCGATAAGCCTGTCGGCATGGCACTGTACTTTTACAACTACAGCACTTGGCGCTCCCGACCT
GGCATCTACCTCGAGGACCTCTTCGTCCAGCCCTCGCACCGCGCCAAGGGCTACGGCAAGCGCCTGCTCGTCGAG
TTGGCCAGGGAGGTCGTCGCCTTGGACGGTCGTCGACTCGAATGGTCGGTGCTCAAGTGGAACGAGCCCAGCATC
AAGTTTTATGAGAGCATAGGCGCCAAGCCCATGAGCGAGTGGGTGGGAATGCGTGTCGATGGTCCGGCTCTCGAC
AAGCTCGCAAGCCTCTTGGACTAG
Transcript >Ophun1|3788
ATGGCATCTTCCGACGTCACGGTGCGACACGCCTGCCGCCAGGACGTTCCCGCCATCCTCGACCTGATCAAGGGC
CTGGCCGAGTACGAAAACGAGCCCAACGCCGTCGAGGCCACCGTCGAGTCCCTGAGCAGCACCCTCGCCTTCGCC
CCCTCTCCCGATCGGGCATCCGTCGCCGACACGGAGCCGACTTCGCCCTCGCGGCCCGCCCGTTGCCTGCTGCTG
CTGCCGCCCGGTGGCGATAAGCCTGTCGGCATGGCACTGTACTTTTACAACTACAGCACTTGGCGCTCCCGACCT
GGCATCTACCTCGAGGACCTCTTCGTCCAGCCCTCGCACCGCGCCAAGGGCTACGGCAAGCGCCTGCTCGTCGAG
TTGGCCAGGGAGGTCGTCGCCTTGGACGGTCGTCGACTCGAATGGTCGGTGCTCAAGTGGAACGAGCCCAGCATC
AAGTTTTATGAGAGCATAGGCGCCAAGCCCATGAGCGAGTGGGTGGGAATGCGTGTCGATGGTCCGGCTCTCGAC
AAGCTCGCAAGCCTCTTGGACTAG
Gene >Ophun1|3788
ATGGCATCTTCCGACGTCACGGTGCGACACGCCTGCCGCCAGGGTCAGTCGCTGCCACCCACCACCATGCTGTCT
GTCTGCTCACTCATCTCTCAGACGTTCCCGCCATCCTCGACCTGATCAAGGGCCTGGCCGAGTACGAAAACGAGC
CCAACGCCGTCGAGGCCACCGTCGAGTCCCTGAGCAGCACCCTCGCCTTCGCCCCCTCTCCCGATCGGGCATCCG
TCGCCGACACGGAGCCGACTTCGCCCTCGCGGCCCGCCCGTTGCCTGCTGCTGCTGCCGCCCGGTGGCGATAAGC
CTGTCGGCATGGCACTGTACTTTTACAACTACAGCACTTGGCGCTCCCGACCTGGCATCTACCTCGAGGACCTCT
TCGTCCAGCCCTCGCACCGCGCCAAGGGCTACGGCAAGCGCCTGCTCGTCGAGTTGGCCAGGGAGGTCGTCGCCT
TGGACGGTCGTCGACTCGAATGGTCGGTGCTCAAGTGGAACGAGCCCAGCATCAAGTTTTATGAGAGCATAGGCG
CCAAGCCCATGAGCGAGTGGGTGGGAATGCGTGTCGATGGTCCGGCTCTCGACAAGCTCGCAAGCCTCTTGGACT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail