Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3784
Gene name
LocationContig_34:33614..34835
Strand+
Gene length (bp)1221
Transcript length (bp)978
Coding sequence length (bp)978
Protein length (aa) 326

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.2E-24 14 296

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P57787|MOT4_MOUSE Monocarboxylate transporter 4 OS=Mus musculus GN=Slc16a3 PE=1 SV=1 20 210 5.0E-14
sp|O35910|MOT4_RAT Monocarboxylate transporter 4 OS=Rattus norvegicus GN=Slc16a3 PE=1 SV=1 20 210 2.0E-13
sp|O15427|MOT4_HUMAN Monocarboxylate transporter 4 OS=Homo sapiens GN=SLC16A3 PE=1 SV=1 20 210 1.0E-12
sp|Q503M4|MT12B_DANRE Monocarboxylate transporter 12-B OS=Danio rerio GN=slc16a12b PE=2 SV=1 22 211 3.0E-11
sp|P57788|MOT4_CHICK Monocarboxylate transporter 4 OS=Gallus gallus GN=SLC16A3 PE=2 SV=1 34 209 4.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P57787|MOT4_MOUSE Monocarboxylate transporter 4 OS=Mus musculus GN=Slc16a3 PE=1 SV=1 20 210 5.0E-14
sp|O35910|MOT4_RAT Monocarboxylate transporter 4 OS=Rattus norvegicus GN=Slc16a3 PE=1 SV=1 20 210 2.0E-13
sp|O15427|MOT4_HUMAN Monocarboxylate transporter 4 OS=Homo sapiens GN=SLC16A3 PE=1 SV=1 20 210 1.0E-12
sp|Q503M4|MT12B_DANRE Monocarboxylate transporter 12-B OS=Danio rerio GN=slc16a12b PE=2 SV=1 22 211 3.0E-11
sp|P57788|MOT4_CHICK Monocarboxylate transporter 4 OS=Gallus gallus GN=SLC16A3 PE=2 SV=1 34 209 4.0E-11
sp|O70451|MOT2_MOUSE Monocarboxylate transporter 2 OS=Mus musculus GN=Slc16a7 PE=1 SV=1 22 251 7.0E-10
sp|P53988|MOT2_MESAU Monocarboxylate transporter 2 OS=Mesocricetus auratus GN=SLC16A7 PE=1 SV=1 22 251 1.0E-09
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 20 277 1.0E-09
sp|Q63344|MOT2_RAT Monocarboxylate transporter 2 OS=Rattus norvegicus GN=Slc16a7 PE=1 SV=1 22 251 2.0E-09
sp|O60669|MOT2_HUMAN Monocarboxylate transporter 2 OS=Homo sapiens GN=SLC16A7 PE=1 SV=2 23 251 8.0E-09
sp|Q7RTY0|MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo sapiens GN=SLC16A13 PE=2 SV=1 23 230 8.0E-09
sp|Q6GM59|MOT12_XENLA Monocarboxylate transporter 12 OS=Xenopus laevis GN=slc16a12 PE=2 SV=1 22 211 1.0E-08
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 23 221 1.0E-08
sp|P36032|MCH2_YEAST Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 34 234 2.0E-08
sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus norvegicus GN=Slc16a13 PE=2 SV=1 23 230 3.0E-08
sp|O70461|MOT3_RAT Monocarboxylate transporter 3 OS=Rattus norvegicus GN=Slc16a8 PE=2 SV=1 20 251 4.0E-08
sp|Q90632|MOT3_CHICK Monocarboxylate transporter 3 OS=Gallus gallus GN=SLC16A3 PE=2 SV=2 20 251 5.0E-08
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 23 230 8.0E-08
sp|O35308|MOT3_MOUSE Monocarboxylate transporter 3 OS=Mus musculus GN=Slc16a8 PE=2 SV=2 20 251 4.0E-07
sp|O95907|MOT3_HUMAN Monocarboxylate transporter 3 OS=Homo sapiens GN=SLC16A8 PE=2 SV=1 20 251 7.0E-07
sp|P53985|MOT1_HUMAN Monocarboxylate transporter 1 OS=Homo sapiens GN=SLC16A1 PE=1 SV=3 17 212 9.0E-07
sp|Q6ZSM3|MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens GN=SLC16A12 PE=1 SV=2 22 211 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

Domain # Start End Length
1 18 36 18
2 43 65 22
3 80 102 22
4 109 128 19
5 152 174 22
6 187 209 22
7 214 236 22
8 243 265 22
9 285 307 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3784
MAPFLLHYLSPHPDRRKLFMWLGAVLVVISSLGAAFSKTPLQIIITQGLLYGIGGGLLFAPSVSFVDEWFVTRRG
LANGIFFGSNNISAAALSPIFSFFLSHYGPRLTLLLWSLTAGVLISVCMFAVHPRKTKLDYDEEAGKLPLGSLRK
PLFLLFALSMMFQGLSNFLPSAYLPSYASDFGVPARHGALLITTMSLSGVIGQPLLGLLTDSIGPLIPLLLSTLV
SGFSILIVWGFGRVYWAMVIQAILFGAFSFSFIVLRSHMAEAVVNDTTKPKEQLFVSGALMAIRGLACIVSGYLG
AAVVASGESTGPQSSYGGEREGLDS*
Coding >Ophun1|3784
ATGGCCCCCTTCCTGCTGCATTATCTCAGCCCCCATCCGGATCGTCGCAAGCTGTTCATGTGGCTTGGCGCTGTT
CTTGTTGTCATCTCTTCTCTTGGCGCCGCCTTTTCTAAAACACCTTTGCAAATCATCATCACTCAGGGCCTGCTC
TACGGCATCGGCGGCGGCCTTCTCTTTGCTCCGTCCGTCAGCTTCGTCGACGAATGGTTCGTGACCCGAAGAGGT
CTCGCCAACGGAATATTTTTCGGCTCCAACAACATCTCCGCCGCCGCCTTATCACCCATCTTCTCCTTCTTCCTC
AGCCACTACGGCCCGCGCCTGACGCTACTACTCTGGAGTCTCACAGCTGGCGTCCTCATATCTGTCTGCATGTTC
GCCGTGCATCCTCGAAAGACCAAGCTCGATTACGACGAAGAAGCCGGGAAACTTCCGCTAGGGTCGTTGAGGAAG
CCTCTTTTCTTGCTCTTTGCGTTGTCCATGATGTTTCAGGGTTTGAGCAACTTTCTCCCCTCGGCGTATTTGCCG
AGTTACGCGTCTGATTTTGGCGTTCCGGCTCGTCATGGGGCGCTTCTTATCACTACCATGAGCTTGTCTGGGGTG
ATTGGGCAGCCTCTTTTAGGGCTTTTGACTGACTCTATCGGACCCCTGATCCCGCTTCTGCTCAGCACTCTGGTT
AGCGGCTTCTCCATACTCATCGTCTGGGGCTTTGGACGCGTTTACTGGGCCATGGTTATCCAAGCAATCCTCTTT
GGAGCCTTCTCCTTCAGCTTCATCGTGCTGAGAAGCCACATGGCGGAGGCGGTTGTCAACGACACCACTAAGCCC
AAGGAGCAGCTTTTCGTCTCCGGCGCCCTGATGGCCATTCGAGGTCTGGCCTGCATCGTGTCGGGATATCTGGGA
GCCGCCGTCGTGGCGTCTGGCGAGAGCACCGGTCCGCAGTCGAGTTACGGCGGTGAGAGGGAGGGTTTGGACAGT
TGA
Transcript >Ophun1|3784
ATGGCCCCCTTCCTGCTGCATTATCTCAGCCCCCATCCGGATCGTCGCAAGCTGTTCATGTGGCTTGGCGCTGTT
CTTGTTGTCATCTCTTCTCTTGGCGCCGCCTTTTCTAAAACACCTTTGCAAATCATCATCACTCAGGGCCTGCTC
TACGGCATCGGCGGCGGCCTTCTCTTTGCTCCGTCCGTCAGCTTCGTCGACGAATGGTTCGTGACCCGAAGAGGT
CTCGCCAACGGAATATTTTTCGGCTCCAACAACATCTCCGCCGCCGCCTTATCACCCATCTTCTCCTTCTTCCTC
AGCCACTACGGCCCGCGCCTGACGCTACTACTCTGGAGTCTCACAGCTGGCGTCCTCATATCTGTCTGCATGTTC
GCCGTGCATCCTCGAAAGACCAAGCTCGATTACGACGAAGAAGCCGGGAAACTTCCGCTAGGGTCGTTGAGGAAG
CCTCTTTTCTTGCTCTTTGCGTTGTCCATGATGTTTCAGGGTTTGAGCAACTTTCTCCCCTCGGCGTATTTGCCG
AGTTACGCGTCTGATTTTGGCGTTCCGGCTCGTCATGGGGCGCTTCTTATCACTACCATGAGCTTGTCTGGGGTG
ATTGGGCAGCCTCTTTTAGGGCTTTTGACTGACTCTATCGGACCCCTGATCCCGCTTCTGCTCAGCACTCTGGTT
AGCGGCTTCTCCATACTCATCGTCTGGGGCTTTGGACGCGTTTACTGGGCCATGGTTATCCAAGCAATCCTCTTT
GGAGCCTTCTCCTTCAGCTTCATCGTGCTGAGAAGCCACATGGCGGAGGCGGTTGTCAACGACACCACTAAGCCC
AAGGAGCAGCTTTTCGTCTCCGGCGCCCTGATGGCCATTCGAGGTCTGGCCTGCATCGTGTCGGGATATCTGGGA
GCCGCCGTCGTGGCGTCTGGCGAGAGCACCGGTCCGCAGTCGAGTTACGGCGGTGAGAGGGAGGGTTTGGACAGT
TGA
Gene >Ophun1|3784
ATGGCCCCCTTCCTGCTGCATTATCTCAGCCCCCATCCGGATCGTCGCAAGCTGTTCATGTGGCTTGGCGCTGTT
CTTGTTGTCATCTCTTCTCTTGGCGCCGCCTTTTCTAAAACAGTGCGTTTACCTATCTATTCCTCTTGTGTGCTT
GACTGACGAAACCAGCCTTTGCAAATCATCATCACTCAGGGCCTGCTCTACGGCATCGGCGGCGGCCTTCTCTTT
GCTCCGTCCGTCAGCTTCGTCGACGAATGGTTCGTGACCCGAAGAGGTCTCGCCAACGGAATATTGTGAGTCTTC
CCTACATGTACATGTATATCCTTCAAACCATCGAAACTAACGGATCCAAGTTTCGGCTCCAACAACATCTCCGCC
GCCGCCTTATCACCCATCTTCTCCTTCTTCCTCAGCCACTACGGCCCGCGCCTGACGCTACTACTCTGGAGTCTC
ACAGCTGGCGTCCTCATATCTGTCTGCATGTTCGCCGTGCATCCTCGAAAGACCAAGCTCGATTACGACGAAGAA
GCCGGGAAACTTCCGCTAGGGTCGTTGAGGAAGCCTCTTTTCTTGCTCTTTGCGTTGTCCATGATGTTTCAGGGT
TTGAGCAACTTTCTCCCCTCGGCGTATTTGCCGAGTTACGCGTCTGATTTTGGCGTTCCGGCTCGTCATGGGGCG
CTTCTTATCACTACCATGAGCTTGTCTGGGGTGATTGGGCAGCCTCTTTTAGGGCTTTTGACGTGAGTCTCTTCA
TCTTGACTTTCTCAAGTAGGACGAGAAGCTAACTCGGTAACAGTGACTCTATCGGACCCCTGATCCCGCTTCTGC
TCAGCACTCTGGTTAGCGGCTTCTCCATACTCATCGTCTGGGGCTTTGGACGCGTTTACTGGGCCATGGTTATCC
AAGCAATCCTCTTTGGAGCCTTCTCCTTCAGCTTCATCGTGCTGAGAAGCCACATGGCGGAGGCGGTTGTCAACG
ACACCACTAAGCCCAAGGAGCAGCTTTTCGTCTCCGGCGCCCTGATGGCCATTCGAGGTCTGGCCTGCATCGTGT
CGGGATATCTGGGAGCCGCCGTCGTGGCGTCTGGCGAGAGCACCGGTCCGCAGTCGAGTTACGGCGGTGGTAAGT
GGCGAGGGCTTATCATTTACTTGGCTGTTTTGATGCTGGGGGCCTCTATTGGCGGGTTGGGGTTCCGTCGAAGAG
AGGGAGGGTTTGGACAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail