Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3783
Gene name
LocationContig_34:30339..32098
Strand-
Gene length (bp)1759
Transcript length (bp)1593
Coding sequence length (bp)1593
Protein length (aa) 531

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09994 DUF2235 Uncharacterized alpha/beta hydrolase domain (DUF2235) 1.9E-86 33 348

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P39992|YEC3_YEAST Uncharacterized protein YEL023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEL023C PE=4 SV=1 33 260 1.0E-39

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6383
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7795
Ophiocordyceps australis map64 (Brazil) OphauB2|3718
Ophiocordyceps camponoti-floridani Ophcf2|05527
Ophiocordyceps camponoti-rufipedis Ophun1|3783 (this protein)
Ophiocordyceps kimflemingae Ophio5|1781

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3783
MATLTAQTTLVPETSSSSLTAASPPPSHKPPTKRLVLFFDGTGNSFSGSNADTNVIKMLNKLARSDSNQLHYYQT
GIGTYDVRHEGSVDNNWLVQKWSSLLQTMDQGFGTTFAAHLMAGYRFLMRYYNAGDKIYMFGFSRGAFIARFLAR
MLNTVGLLCKGNEEMVRFAYTLYRRHLQGETQAVSEEVEAFSRTFCRRETIPGGKAGAETNVRVFFLGIWDCVNS
VSVLERNAPAAATVAGTAHHVRHAVAVDERRVKFRPALLAQDARSANSDEDIREVWFPGCHGDVGGGWPAETAAP
TGGLDQGGGKWQKLRSLFRTRKPVKSTAHAREDKFQMSDVPLAWMMSEIQAIGETVPEAALRFGPSACGFHRRYK
ERREQTRSSVLHDSLRFGHGTGFFRVLLWRFLEYMPFISRRELIQDKWVNKRLRPNRGSARDIPPDAVMHESLVE
RLQLNHHYHPLNNHGDDLDPCLKCHGRAAEFKLERSDRPEHKTYVFAKLLNGTNGVNGTNGINGTDGVHTNGTNG
YGMMA*
Coding >Ophun1|3783
ATGGCAACCCTCACAGCCCAGACAACGCTCGTACCAGAAACCAGCTCCAGCTCGCTCACAGCCGCCTCTCCTCCA
CCATCGCACAAGCCCCCGACCAAGAGACTGGTCCTCTTCTTCGATGGCACCGGCAACAGCTTCAGCGGCTCCAAC
GCCGACACAAACGTCATCAAGATGCTCAACAAGCTGGCACGCAGCGACTCGAATCAGCTGCACTACTACCAGACT
GGCATCGGCACCTACGACGTTAGACACGAGGGCTCCGTCGATAACAACTGGCTCGTTCAGAAATGGAGCTCGCTT
CTGCAGACGATGGATCAGGGCTTTGGCACTACCTTTGCCGCTCATCTCATGGCCGGCTACCGCTTCCTGATGCGC
TACTACAACGCCGGCGACAAGATCTACATGTTTGGCTTCAGCCGCGGCGCCTTCATAGCCCGCTTCCTCGCCCGC
ATGCTCAACACCGTGGGCCTCCTCTGCAAAGGCAACGAAGAAATGGTCCGCTTCGCCTACACGCTGTACCGCCGC
CACCTCCAAGGCGAAACCCAAGCCGTCAGCGAAGAAGTCGAAGCCTTCAGCCGTACCTTTTGCCGCCGGGAGACG
ATCCCCGGTGGTAAAGCCGGGGCCGAGACCAACGTCCGCGTCTTCTTCCTCGGAATCTGGGACTGCGTCAACTCG
GTTTCTGTGCTGGAGCGGAATGCTCCCGCTGCGGCTACCGTCGCGGGAACGGCTCATCATGTCAGACACGCCGTT
GCCGTTGATGAGCGTCGTGTCAAGTTCCGGCCTGCTTTGCTGGCGCAGGATGCTCGTTCTGCCAACTCGGACGAG
GATATACGAGAGGTTTGGTTCCCGGGCTGTCACGGTGATGTTGGCGGTGGGTGGCCTGCTGAGACGGCTGCTCCT
ACTGGGGGACTTGACCAAGGGGGTGGGAAGTGGCAGAAGCTTCGCTCTCTGTTTCGAACCAGGAAACCTGTCAAG
AGCACGGCTCACGCTCGGGAGGACAAGTTTCAGATGAGTGACGTGCCGCTTGCGTGGATGATGAGCGAGATTCAG
GCCATTGGTGAGACGGTTCCTGAGGCCGCCTTGCGGTTCGGTCCGAGTGCCTGTGGGTTCCATCGTCGGTATAAG
GAACGAAGGGAGCAGACGAGGTCGAGCGTGCTTCACGACTCGCTGCGGTTCGGTCACGGAACTGGCTTCTTCCGC
GTCTTGCTATGGCGCTTCCTCGAATACATGCCCTTCATCTCTCGCAGGGAACTCATCCAGGATAAATGGGTCAAC
AAGCGGCTCCGTCCCAACCGGGGGAGCGCCCGCGACATTCCTCCAGACGCCGTCATGCACGAGTCTCTGGTTGAG
CGTCTGCAGTTAAACCACCACTATCACCCGCTCAACAACCATGGTGATGATCTCGATCCCTGTCTCAAGTGTCAT
GGACGGGCTGCCGAGTTTAAGCTAGAACGAAGCGACCGTCCTGAGCATAAGACGTACGTCTTTGCTAAGTTGTTG
AATGGGACGAATGGGGTCAACGGGACGAATGGGATCAATGGGACTGATGGGGTGCATACGAACGGTACCAATGGT
TACGGTATGATGGCTTAG
Transcript >Ophun1|3783
ATGGCAACCCTCACAGCCCAGACAACGCTCGTACCAGAAACCAGCTCCAGCTCGCTCACAGCCGCCTCTCCTCCA
CCATCGCACAAGCCCCCGACCAAGAGACTGGTCCTCTTCTTCGATGGCACCGGCAACAGCTTCAGCGGCTCCAAC
GCCGACACAAACGTCATCAAGATGCTCAACAAGCTGGCACGCAGCGACTCGAATCAGCTGCACTACTACCAGACT
GGCATCGGCACCTACGACGTTAGACACGAGGGCTCCGTCGATAACAACTGGCTCGTTCAGAAATGGAGCTCGCTT
CTGCAGACGATGGATCAGGGCTTTGGCACTACCTTTGCCGCTCATCTCATGGCCGGCTACCGCTTCCTGATGCGC
TACTACAACGCCGGCGACAAGATCTACATGTTTGGCTTCAGCCGCGGCGCCTTCATAGCCCGCTTCCTCGCCCGC
ATGCTCAACACCGTGGGCCTCCTCTGCAAAGGCAACGAAGAAATGGTCCGCTTCGCCTACACGCTGTACCGCCGC
CACCTCCAAGGCGAAACCCAAGCCGTCAGCGAAGAAGTCGAAGCCTTCAGCCGTACCTTTTGCCGCCGGGAGACG
ATCCCCGGTGGTAAAGCCGGGGCCGAGACCAACGTCCGCGTCTTCTTCCTCGGAATCTGGGACTGCGTCAACTCG
GTTTCTGTGCTGGAGCGGAATGCTCCCGCTGCGGCTACCGTCGCGGGAACGGCTCATCATGTCAGACACGCCGTT
GCCGTTGATGAGCGTCGTGTCAAGTTCCGGCCTGCTTTGCTGGCGCAGGATGCTCGTTCTGCCAACTCGGACGAG
GATATACGAGAGGTTTGGTTCCCGGGCTGTCACGGTGATGTTGGCGGTGGGTGGCCTGCTGAGACGGCTGCTCCT
ACTGGGGGACTTGACCAAGGGGGTGGGAAGTGGCAGAAGCTTCGCTCTCTGTTTCGAACCAGGAAACCTGTCAAG
AGCACGGCTCACGCTCGGGAGGACAAGTTTCAGATGAGTGACGTGCCGCTTGCGTGGATGATGAGCGAGATTCAG
GCCATTGGTGAGACGGTTCCTGAGGCCGCCTTGCGGTTCGGTCCGAGTGCCTGTGGGTTCCATCGTCGGTATAAG
GAACGAAGGGAGCAGACGAGGTCGAGCGTGCTTCACGACTCGCTGCGGTTCGGTCACGGAACTGGCTTCTTCCGC
GTCTTGCTATGGCGCTTCCTCGAATACATGCCCTTCATCTCTCGCAGGGAACTCATCCAGGATAAATGGGTCAAC
AAGCGGCTCCGTCCCAACCGGGGGAGCGCCCGCGACATTCCTCCAGACGCCGTCATGCACGAGTCTCTGGTTGAG
CGTCTGCAGTTAAACCACCACTATCACCCGCTCAACAACCATGGTGATGATCTCGATCCCTGTCTCAAGTGTCAT
GGACGGGCTGCCGAGTTTAAGCTAGAACGAAGCGACCGTCCTGAGCATAAGACGTACGTCTTTGCTAAGTTGTTG
AATGGGACGAATGGGGTCAACGGGACGAATGGGATCAATGGGACTGATGGGGTGCATACGAACGGTACCAATGGT
TACGGTATGATGGCTTAG
Gene >Ophun1|3783
ATGGCAACCCTCACAGCCCAGACAACGCTCGTACCAGAAACCAGCTCCAGCTCGCTCACAGCCGCCTCTCCTCCA
CCATCGCACAAGCCCCCGACCAAGAGACTGGTCCTCTTCTTCGATGGCACCGGCAACAGCTTCAGCGGCTCCAAC
GCCGACACAAACGTCATCAAGATGCTCAACAAGCTGGCACGCAGCGACTCGAATCAGCTGCACTACTACCAGAGT
GAGCCCTCTGCTTCTCTCTTGTCTCAAGAGTTCAACTACTTACATCTGTGTGTCAAGCTGGCATCGGCACCTACG
ACGTTAGACACGAGGGCTCCGTCGATAACAACTGGCTCGTTCAGAAATGGAGCTCGCTTCTGCAGACGATGGATC
AGGGCTTTGGCACTACCTTTGCCGCTCATCTCATGGCCGGCTACCGCTTCCTGATGCGCTACTACAACGCCGTAC
GTCCCCATGGCTTCACCATAGTCTCTTCCATCGCTGACCATCCCCTTCAGGGCGACAAGATCTACATGTTTGGCT
TCAGCCGCGGCGCCTTCATAGCCCGCTTCCTCGCCCGCATGCTCAACACCGTGGGCCTCCTCTGCAAAGGCAACG
AAGAAATGGTCCGCTTCGCCTACACGCTGTACCGCCGCCACCTCCAAGGCGAAACCCAAGCCGTCAGCGAAGAAG
TCGAAGCCTTCAGCCGTACCTTTTGCCGCCGGGAGACGATCCCCGGTGGTAAAGCCGGGGCCGAGACCAACGTCC
GCGTCTTCTTCCTCGGAATCTGGGACTGCGTCAACTCGGTTTCTGTGCTGGAGCGGAATGCTCCCGCTGCGGCTA
CCGTCGCGGGAACGGCTCATCATGTCAGACACGCCGTTGCCGTTGATGAGCGTCGTGTCAAGTTCCGGCCTGCTT
TGCTGGCGCAGGATGCTCGTTCTGCCAACTCGGACGAGGATATACGAGAGGTTTGGTTCCCGGGCTGTCACGGTG
ATGTTGGCGGTGGGTGGCCTGCTGAGACGGCTGCTCCTACTGGGGGACTTGACCAAGGGGGTGGGAAGTGGCAGA
AGCTTCGCTCTCTGTTTCGAACCAGGAAACCTGTCAAGAGCACGGCTCACGCTCGGGAGGACAAGTTTCAGATGA
GTGACGTGCCGCTTGCGTGGATGATGAGCGAGATTCAGGCCATTGGTGAGACGGTTCCTGAGGCCGCCTTGCGGT
TCGGTCCGAGTGCCTGTGGGTTCCATCGTCGGTATAAGGAACGAAGGGAGCAGACGAGGTCGAGCGTGCTTCACG
ACTCGCTGCGGTTCGGTCACGGAACTGGCTTCTTCCGCGTCTTGCTATGGCGCTTCCTCGGTAAGAGTCATGGTA
TAATCCTATCAGATGAATAAGACTAACACGGACTCTAGAATACATGCCCTTCATCTCTCGCAGGGAACTCATCCA
GGATAAATGGGTCAACAAGCGGCTCCGTCCCAACCGGGGGAGCGCCCGCGACATTCCTCCAGACGCCGTCATGCA
CGAGTCTCTGGTTGAGCGTCTGCAGTTAAACCACCACTATCACCCGCTCAACAACCATGGTGATGATCTCGATCC
CTGTCTCAAGTGTCATGGACGGGCTGCCGAGTTTAAGCTAGAACGAAGCGACCGTCCTGAGCATAAGACGTACGT
CTTTGCTAAGTTGTTGAATGGGACGAATGGGGTCAACGGGACGAATGGGATCAATGGGACTGATGGGGTGCATAC
GAACGGTACCAATGGTTACGGTATGATGGCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail