Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3778
Gene name
LocationContig_34:19248..20787
Strand+
Gene length (bp)1539
Transcript length (bp)1485
Coding sequence length (bp)1485
Protein length (aa) 495

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 6.6E-34 55 421

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 10 494 1.0E-75
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 36 494 7.0E-73
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 34 494 2.0E-70
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 11 493 3.0E-67
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 37 494 2.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 10 494 1.0E-75
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 36 494 7.0E-73
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 34 494 2.0E-70
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 11 493 3.0E-67
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 37 494 2.0E-60
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 37 343 1.0E-47
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 37 420 3.0E-47
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 30 494 2.0E-42
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 34 492 1.0E-38
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 38 492 5.0E-38
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 34 481 7.0E-37
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 34 471 1.0E-36
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 46 468 2.0E-35
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 28 343 8.0E-34
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 37 493 8.0E-32
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 12 467 9.0E-32
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 34 480 3.0E-31
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 38 453 6.0E-30
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 16 468 2.0E-28
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 12 494 1.0E-27
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 4 467 1.0E-26
sp|O13879|YE1F_SCHPO Uncharacterized transporter C1B3.15C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.15c PE=3 SV=1 35 422 1.0E-26
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 26 465 3.0E-26
sp|P53241|VHT1_YEAST Vitamin H transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHT1 PE=1 SV=1 10 446 2.0E-21
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 30 346 4.0E-18
sp|Q0K843|SAUU_CUPNH Probable sulfoacetate transporter SauU OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauU PE=2 SV=1 48 252 1.0E-11
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 30 474 1.0E-11
sp|P39398|LGOT_ECOLI Probable L-galactonate transporter OS=Escherichia coli (strain K12) GN=lgoT PE=1 SV=2 29 355 3.0E-11
sp|P0AA76|DGOT_ECOLI D-galactonate transporter OS=Escherichia coli (strain K12) GN=dgoT PE=1 SV=1 54 354 1.0E-10
sp|P0AA77|DGOT_ECOL6 D-galactonate transporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dgoT PE=3 SV=1 54 354 1.0E-10
sp|Q46916|GUDP_ECOLI Probable glucarate transporter OS=Escherichia coli (strain K12) GN=gudP PE=1 SV=1 35 343 9.0E-10
sp|P0CF20|YO163_YEAST Putative uncharacterized transporter YOL163W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL163W PE=5 SV=1 143 257 6.0E-08
sp|P37489|YYBO_BACSU Uncharacterized transporter YybO OS=Bacillus subtilis (strain 168) GN=yybO PE=3 SV=1 18 333 1.0E-07
sp|P42237|GUDP_BACSU Probable glucarate transporter OS=Bacillus subtilis (strain 168) GN=gudP PE=3 SV=2 54 179 3.0E-06
sp|O61369|PICO_DROAN Putative inorganic phosphate cotransporter OS=Drosophila ananassae GN=Picot PE=3 SV=1 94 433 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 48 67 19
2 87 109 22
3 116 135 19
4 145 167 22
5 176 198 22
6 208 230 22
7 283 305 22
8 320 337 17
9 344 366 22
10 371 393 22
11 405 424 19
12 434 456 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3778
MAVEMASAGGDLKHKTSTESQQAQWQQTVECPPHTTERKLLARIDMHVVPFLCIMYLLAFLDRVNISNADLFGLS
KDLDLGATSTKFNTALVIFFVPYCLFEIPSNMLLKRFRPHVWLALNMFLFGFTTMMQGLVRSYGGLLACRFFLGL
FETGMFPGAFYLIGMWYRRHEAQKRYSFFFGSTTLAGAFGGLLAAALGQMAGLRGFSGWRWIFLIEGAITVFFSF
FFFFLLPDFPEDSKWLTTDEKNFVAARLRLDQGRSAVERPVTFRDVAAVLSDPKVILGGFMYLGLIVPAYGYAYF
SPFIISGYGYSPVQTQLHSVPPWAAAFVTAMVVAYLSDRMRHRFAFALVSILVCITGFGILIGVSHHRDLQYAAL
FLFAAGAYTAMPIIVCWFNMNLGGHHRRAVGSAWQVGFGNLGGIIAVFIFQKKDGPRFIPGLSIALAFAAVSIVA
CSLYALSCLKDNRQRSRSASDPVELAGEEKTTLGDKSPDYRYLL*
Coding >Ophun1|3778
ATGGCAGTCGAGATGGCCTCTGCTGGCGGCGATCTCAAGCACAAGACCTCTACTGAGAGCCAGCAGGCGCAATGG
CAGCAGACGGTCGAGTGTCCTCCTCACACGACGGAGCGCAAGTTGCTGGCCCGTATCGACATGCACGTTGTGCCC
TTTCTGTGCATCATGTATCTCCTGGCCTTTCTCGACCGCGTCAACATATCCAATGCCGACCTCTTTGGTCTCTCC
AAGGATCTCGATCTCGGAGCCACCAGCACCAAGTTCAACACGGCCCTCGTCATCTTCTTCGTCCCCTACTGCCTC
TTCGAGATACCCTCCAATATGCTGCTGAAGCGCTTCCGCCCCCACGTCTGGCTCGCCCTCAACATGTTCCTCTTC
GGCTTCACCACCATGATGCAGGGCCTGGTTCGCAGCTACGGCGGTCTACTCGCCTGCCGCTTCTTCCTCGGCCTC
TTTGAGACGGGCATGTTCCCGGGCGCCTTTTACCTCATCGGCATGTGGTACCGTCGCCACGAGGCTCAGAAGCGG
TACTCCTTCTTTTTCGGTAGCACCACGCTCGCCGGCGCCTTTGGAGGTCTGCTGGCTGCTGCTCTCGGTCAGATG
GCCGGTCTGCGCGGCTTCAGCGGTTGGCGCTGGATCTTCCTGATTGAAGGCGCCATCACCGTCTTCTTCAGCTTC
TTCTTCTTCTTCCTGCTGCCCGACTTCCCCGAGGACTCCAAGTGGTTGACGACGGACGAAAAGAACTTTGTCGCT
GCTCGTCTCCGTCTCGATCAGGGACGCTCGGCTGTCGAACGCCCCGTCACGTTTCGAGACGTTGCTGCCGTCCTG
TCAGACCCCAAGGTTATCCTCGGCGGCTTCATGTATCTGGGACTCATCGTGCCCGCCTACGGCTACGCCTATTTC
TCGCCATTCATCATCTCAGGCTACGGCTACAGCCCTGTTCAGACGCAGCTGCATAGCGTTCCGCCCTGGGCCGCT
GCCTTTGTCACCGCCATGGTGGTCGCCTATCTTTCGGACCGGATGCGACACCGCTTCGCCTTTGCCCTGGTCTCG
ATCCTCGTCTGTATCACCGGCTTCGGCATCCTCATCGGCGTCAGTCACCATCGAGATCTGCAGTACGCTGCTCTC
TTCCTCTTCGCCGCCGGCGCTTACACCGCCATGCCCATCATCGTCTGCTGGTTCAACATGAACCTCGGCGGCCAC
CACCGTCGAGCCGTCGGAAGCGCCTGGCAGGTCGGCTTTGGCAACCTGGGCGGCATCATCGCAGTCTTCATCTTT
CAGAAAAAAGACGGGCCCAGGTTCATTCCCGGCCTCAGCATCGCGCTGGCCTTTGCCGCCGTGAGCATCGTCGCC
TGCAGTCTGTACGCCCTCTCATGTCTGAAAGACAATCGCCAAAGATCAAGATCGGCAAGTGACCCTGTCGAGCTG
GCTGGGGAGGAAAAGACGACTCTAGGCGACAAGTCTCCCGACTATCGCTATCTTCTTTGA
Transcript >Ophun1|3778
ATGGCAGTCGAGATGGCCTCTGCTGGCGGCGATCTCAAGCACAAGACCTCTACTGAGAGCCAGCAGGCGCAATGG
CAGCAGACGGTCGAGTGTCCTCCTCACACGACGGAGCGCAAGTTGCTGGCCCGTATCGACATGCACGTTGTGCCC
TTTCTGTGCATCATGTATCTCCTGGCCTTTCTCGACCGCGTCAACATATCCAATGCCGACCTCTTTGGTCTCTCC
AAGGATCTCGATCTCGGAGCCACCAGCACCAAGTTCAACACGGCCCTCGTCATCTTCTTCGTCCCCTACTGCCTC
TTCGAGATACCCTCCAATATGCTGCTGAAGCGCTTCCGCCCCCACGTCTGGCTCGCCCTCAACATGTTCCTCTTC
GGCTTCACCACCATGATGCAGGGCCTGGTTCGCAGCTACGGCGGTCTACTCGCCTGCCGCTTCTTCCTCGGCCTC
TTTGAGACGGGCATGTTCCCGGGCGCCTTTTACCTCATCGGCATGTGGTACCGTCGCCACGAGGCTCAGAAGCGG
TACTCCTTCTTTTTCGGTAGCACCACGCTCGCCGGCGCCTTTGGAGGTCTGCTGGCTGCTGCTCTCGGTCAGATG
GCCGGTCTGCGCGGCTTCAGCGGTTGGCGCTGGATCTTCCTGATTGAAGGCGCCATCACCGTCTTCTTCAGCTTC
TTCTTCTTCTTCCTGCTGCCCGACTTCCCCGAGGACTCCAAGTGGTTGACGACGGACGAAAAGAACTTTGTCGCT
GCTCGTCTCCGTCTCGATCAGGGACGCTCGGCTGTCGAACGCCCCGTCACGTTTCGAGACGTTGCTGCCGTCCTG
TCAGACCCCAAGGTTATCCTCGGCGGCTTCATGTATCTGGGACTCATCGTGCCCGCCTACGGCTACGCCTATTTC
TCGCCATTCATCATCTCAGGCTACGGCTACAGCCCTGTTCAGACGCAGCTGCATAGCGTTCCGCCCTGGGCCGCT
GCCTTTGTCACCGCCATGGTGGTCGCCTATCTTTCGGACCGGATGCGACACCGCTTCGCCTTTGCCCTGGTCTCG
ATCCTCGTCTGTATCACCGGCTTCGGCATCCTCATCGGCGTCAGTCACCATCGAGATCTGCAGTACGCTGCTCTC
TTCCTCTTCGCCGCCGGCGCTTACACCGCCATGCCCATCATCGTCTGCTGGTTCAACATGAACCTCGGCGGCCAC
CACCGTCGAGCCGTCGGAAGCGCCTGGCAGGTCGGCTTTGGCAACCTGGGCGGCATCATCGCAGTCTTCATCTTT
CAGAAAAAAGACGGGCCCAGGTTCATTCCCGGCCTCAGCATCGCGCTGGCCTTTGCCGCCGTGAGCATCGTCGCC
TGCAGTCTGTACGCCCTCTCATGTCTGAAAGACAATCGCCAAAGATCAAGATCGGCAAGTGACCCTGTCGAGCTG
GCTGGGGAGGAAAAGACGACTCTAGGCGACAAGTCTCCCGACTATCGCTATCTTCTTTGA
Gene >Ophun1|3778
ATGGCAGTCGAGATGGCCTCTGCTGGCGGCGATCTCAAGCACAAGACCTCTACTGAGAGCCAGCAGGCGCAATGG
CAGCAGACGGTCGAGTGTCCTCCTCACACGACGGAGCGCAAGTTGCTGGCCCGTATCGACATGCACGTTGTGCCC
TTTCTGTGCATCATGTATCTCCTGGCCTTTCTCGGTGAGCCTCTCTTGTCCTCTCTACCTAGAGAGTCATCTCGT
TGATGCTCTATAGACCGCGTCAACATATCCAATGCCGACCTCTTTGGTCTCTCCAAGGATCTCGATCTCGGAGCC
ACCAGCACCAAGTTCAACACGGCCCTCGTCATCTTCTTCGTCCCCTACTGCCTCTTCGAGATACCCTCCAATATG
CTGCTGAAGCGCTTCCGCCCCCACGTCTGGCTCGCCCTCAACATGTTCCTCTTCGGCTTCACCACCATGATGCAG
GGCCTGGTTCGCAGCTACGGCGGTCTACTCGCCTGCCGCTTCTTCCTCGGCCTCTTTGAGACGGGCATGTTCCCG
GGCGCCTTTTACCTCATCGGCATGTGGTACCGTCGCCACGAGGCTCAGAAGCGGTACTCCTTCTTTTTCGGTAGC
ACCACGCTCGCCGGCGCCTTTGGAGGTCTGCTGGCTGCTGCTCTCGGTCAGATGGCCGGTCTGCGCGGCTTCAGC
GGTTGGCGCTGGATCTTCCTGATTGAAGGCGCCATCACCGTCTTCTTCAGCTTCTTCTTCTTCTTCCTGCTGCCC
GACTTCCCCGAGGACTCCAAGTGGTTGACGACGGACGAAAAGAACTTTGTCGCTGCTCGTCTCCGTCTCGATCAG
GGACGCTCGGCTGTCGAACGCCCCGTCACGTTTCGAGACGTTGCTGCCGTCCTGTCAGACCCCAAGGTTATCCTC
GGCGGCTTCATGTATCTGGGACTCATCGTGCCCGCCTACGGCTACGCCTATTTCTCGCCATTCATCATCTCAGGC
TACGGCTACAGCCCTGTTCAGACGCAGCTGCATAGCGTTCCGCCCTGGGCCGCTGCCTTTGTCACCGCCATGGTG
GTCGCCTATCTTTCGGACCGGATGCGACACCGCTTCGCCTTTGCCCTGGTCTCGATCCTCGTCTGTATCACCGGC
TTCGGCATCCTCATCGGCGTCAGTCACCATCGAGATCTGCAGTACGCTGCTCTCTTCCTCTTCGCCGCCGGCGCT
TACACCGCCATGCCCATCATCGTCTGCTGGTTCAACATGAACCTCGGCGGCCACCACCGTCGAGCCGTCGGAAGC
GCCTGGCAGGTCGGCTTTGGCAACCTGGGCGGCATCATCGCAGTCTTCATCTTTCAGAAAAAAGACGGGCCCAGG
TTCATTCCCGGCCTCAGCATCGCGCTGGCCTTTGCCGCCGTGAGCATCGTCGCCTGCAGTCTGTACGCCCTCTCA
TGTCTGAAAGACAATCGCCAAAGATCAAGATCGGCAAGTGACCCTGTCGAGCTGGCTGGGGAGGAAAAGACGACT
CTAGGCGACAAGTCTCCCGACTATCGCTATCTTCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail