Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3775
Gene name
LocationContig_34:12646..13210
Strand+
Gene length (bp)564
Transcript length (bp)564
Coding sequence length (bp)564
Protein length (aa) 188

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16541 AltA1 Alternaria alternata allergen 1 1.3E-24 42 171

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.999644

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2975
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5511
Ophiocordyceps australis map64 (Brazil) OphauB2|1869
Ophiocordyceps camponoti-floridani Ophcf2|05534
Ophiocordyceps camponoti-rufipedis Ophun1|3775 (this protein)
Ophiocordyceps kimflemingae Ophio5|5387
Ophiocordyceps subramaniannii Hirsu2|5073

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3775
MRSFLVALLLAGSALSAPAETPAAKKSPSCTSNSSKVREWTVSNFDFHASYIFSTPAHQNSWGYVNFTLINPIFA
WKLNCAAASNQLEDFFYGTVPYKCETPGNIEDASFSFSRPSGELLINQTWDCPYEGSRFTARGGVKLDLKCRETR
QDNPNWKSPADGFASTRTISCDHVTVKAPVTEMSGVA*
Coding >Ophun1|3775
ATGCGCAGCTTCCTGGTCGCCCTCCTCCTCGCCGGTTCGGCCCTCAGCGCACCGGCCGAGACACCAGCAGCCAAG
AAGTCGCCATCCTGCACGTCCAACTCTTCCAAAGTGCGCGAGTGGACCGTCTCCAACTTCGACTTCCACGCCTCA
TACATCTTCTCGACGCCCGCGCACCAAAACTCGTGGGGATACGTCAACTTCACCCTCATCAACCCCATCTTCGCG
TGGAAGCTCAACTGCGCCGCCGCGTCCAACCAGCTCGAAGACTTCTTCTACGGCACCGTCCCCTACAAGTGCGAG
ACGCCCGGCAACATTGAGGACGCCTCCTTTTCCTTCTCGCGGCCGTCGGGCGAGCTCCTCATCAACCAGACTTGG
GACTGCCCCTACGAGGGAAGCCGGTTCACGGCCCGTGGCGGCGTCAAGCTGGATCTCAAGTGCCGGGAAACTCGC
CAGGACAATCCGAACTGGAAGTCGCCGGCCGATGGCTTCGCCTCGACCCGCACGATTAGCTGCGATCACGTCACG
GTCAAGGCGCCCGTCACGGAGATGAGCGGCGTCGCTTGA
Transcript >Ophun1|3775
ATGCGCAGCTTCCTGGTCGCCCTCCTCCTCGCCGGTTCGGCCCTCAGCGCACCGGCCGAGACACCAGCAGCCAAG
AAGTCGCCATCCTGCACGTCCAACTCTTCCAAAGTGCGCGAGTGGACCGTCTCCAACTTCGACTTCCACGCCTCA
TACATCTTCTCGACGCCCGCGCACCAAAACTCGTGGGGATACGTCAACTTCACCCTCATCAACCCCATCTTCGCG
TGGAAGCTCAACTGCGCCGCCGCGTCCAACCAGCTCGAAGACTTCTTCTACGGCACCGTCCCCTACAAGTGCGAG
ACGCCCGGCAACATTGAGGACGCCTCCTTTTCCTTCTCGCGGCCGTCGGGCGAGCTCCTCATCAACCAGACTTGG
GACTGCCCCTACGAGGGAAGCCGGTTCACGGCCCGTGGCGGCGTCAAGCTGGATCTCAAGTGCCGGGAAACTCGC
CAGGACAATCCGAACTGGAAGTCGCCGGCCGATGGCTTCGCCTCGACCCGCACGATTAGCTGCGATCACGTCACG
GTCAAGGCGCCCGTCACGGAGATGAGCGGCGTCGCTTGA
Gene >Ophun1|3775
ATGCGCAGCTTCCTGGTCGCCCTCCTCCTCGCCGGTTCGGCCCTCAGCGCACCGGCCGAGACACCAGCAGCCAAG
AAGTCGCCATCCTGCACGTCCAACTCTTCCAAAGTGCGCGAGTGGACCGTCTCCAACTTCGACTTCCACGCCTCA
TACATCTTCTCGACGCCCGCGCACCAAAACTCGTGGGGATACGTCAACTTCACCCTCATCAACCCCATCTTCGCG
TGGAAGCTCAACTGCGCCGCCGCGTCCAACCAGCTCGAAGACTTCTTCTACGGCACCGTCCCCTACAAGTGCGAG
ACGCCCGGCAACATTGAGGACGCCTCCTTTTCCTTCTCGCGGCCGTCGGGCGAGCTCCTCATCAACCAGACTTGG
GACTGCCCCTACGAGGGAAGCCGGTTCACGGCCCGTGGCGGCGTCAAGCTGGATCTCAAGTGCCGGGAAACTCGC
CAGGACAATCCGAACTGGAAGTCGCCGGCCGATGGCTTCGCCTCGACCCGCACGATTAGCTGCGATCACGTCACG
GTCAAGGCGCCCGTCACGGAGATGAGCGGCGTCGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail