Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3767
Gene name
LocationContig_339:11581..15629
Strand+
Gene length (bp)4048
Transcript length (bp)3990
Coding sequence length (bp)3990
Protein length (aa) 1330

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 3.4E-22 989 1137
PF00072 Response_reg Response regulator receiver domain 2.3E-21 1187 1313
PF00512 HisKA His Kinase A (phospho-acceptor) domain 3.7E-07 859 936

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q86CZ2|DHKK_DICDI Hybrid signal transduction histidine kinase K OS=Dictyostelium discoideum GN=dhkK PE=1 SV=1 849 1323 3.0E-35
sp|Q9KLK7|LUXQ_VIBCH Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=luxQ PE=1 SV=1 822 1316 7.0E-29
sp|P26762|BVGS_BORBR Virulence sensor protein BvgS OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=bvgS PE=3 SV=2 710 1319 2.0E-28
sp|P40330|BVGS_BORPA Virulence sensor protein BvgS OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=bvgS PE=3 SV=2 710 1319 3.0E-28
sp|P16575|BVGS_BORPE Virulence sensor protein BvgS OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=bvgS PE=1 SV=3 710 1319 5.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q86CZ2|DHKK_DICDI Hybrid signal transduction histidine kinase K OS=Dictyostelium discoideum GN=dhkK PE=1 SV=1 849 1323 3.0E-35
sp|Q9KLK7|LUXQ_VIBCH Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=luxQ PE=1 SV=1 822 1316 7.0E-29
sp|P26762|BVGS_BORBR Virulence sensor protein BvgS OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=bvgS PE=3 SV=2 710 1319 2.0E-28
sp|P40330|BVGS_BORPA Virulence sensor protein BvgS OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=bvgS PE=3 SV=2 710 1319 3.0E-28
sp|P16575|BVGS_BORPE Virulence sensor protein BvgS OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=bvgS PE=1 SV=3 710 1319 5.0E-28
sp|Q9HUI3|ARUS_PSEAE Sensor histidine kinase AruS OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruS PE=3 SV=1 849 1316 7.0E-27
sp|P0AEC4|ARCB_SHIFL Aerobic respiration control sensor protein ArcB OS=Shigella flexneri GN=arcB PE=3 SV=1 845 1316 7.0E-27
sp|P0AEC3|ARCB_ECOLI Aerobic respiration control sensor protein ArcB OS=Escherichia coli (strain K12) GN=arcB PE=1 SV=1 845 1316 7.0E-27
sp|P58363|ARCB_ECO57 Aerobic respiration control sensor protein ArcB OS=Escherichia coli O157:H7 GN=arcB PE=3 SV=1 845 1316 8.0E-27
sp|Q9P896|TCSA_EMENI Two-component system protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsA PE=3 SV=2 834 1310 3.0E-26
sp|Q8D5Z6|LUXQ_VIBVU Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain CMCP6) GN=luxQ PE=3 SV=1 834 1309 2.0E-24
sp|Q7MD16|LUXQ_VIBVY Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain YJ016) GN=luxQ PE=3 SV=1 834 1309 6.0E-24
sp|Q9P4U6|TCSB_EMENI Two-component system protein B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsB PE=1 SV=2 983 1309 5.0E-23
sp|P0C0F7|RPFC_XANC8 Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpfC PE=3 SV=2 851 1327 5.0E-23
sp|P0C0F6|RPFC_XANCP Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpfC PE=1 SV=2 851 1327 7.0E-23
sp|Q54U87|DHKA_DICDI Hybrid signal transduction histidine kinase A OS=Dictyostelium discoideum GN=dhkA PE=1 SV=1 830 1208 1.0E-22
sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 632 1138 1.0E-22
sp|A1A699|OHK6_ORYSJ Probable histidine kinase 6 OS=Oryza sativa subsp. japonica GN=HK6 PE=1 SV=1 846 1317 3.0E-21
sp|P48027|GACS_PSESY Sensor protein GacS OS=Pseudomonas syringae pv. syringae GN=gacS PE=3 SV=1 849 1131 5.0E-21
sp|Q3S4A7|AHK5_ARATH Histidine kinase 5 OS=Arabidopsis thaliana GN=AHK5 PE=1 SV=1 867 1135 6.0E-21
sp|Q5A599|NIK1_CANAL Histidine protein kinase NIK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIK1 PE=1 SV=2 851 1135 8.0E-21
sp|P54302|LUXQ_VIBHA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio harveyi GN=luxQ PE=1 SV=1 822 1305 1.0E-20
sp|Q87GU5|LUXQ_VIBPA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=luxQ PE=3 SV=1 822 1305 7.0E-20
sp|Q9P7Q7|MAK1_SCHPO Peroxide stress-activated histidine kinase mak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak1 PE=3 SV=1 714 1131 9.0E-20
sp|A1A697|OHK5_ORYSJ Probable histidine kinase 5 OS=Oryza sativa subsp. japonica GN=HK5 PE=2 SV=1 849 1318 1.0E-19
sp|A2YFR6|OHK1_ORYSI Probable histidine kinase 1 OS=Oryza sativa subsp. indica GN=HK1 PE=3 SV=1 867 1135 3.0E-19
sp|A3BE68|OHK1_ORYSJ Probable histidine kinase 1 OS=Oryza sativa subsp. japonica GN=HK1 PE=2 SV=1 867 1135 3.0E-19
sp|P39453|TORS_ECOLI Sensor protein TorS OS=Escherichia coli (strain K12) GN=torS PE=1 SV=4 849 1261 6.0E-19
sp|P58356|TORS_ECO57 Sensor protein TorS OS=Escherichia coli O157:H7 GN=torS PE=3 SV=1 849 1261 9.0E-19
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase B OS=Dictyostelium discoideum GN=dhkB PE=1 SV=1 831 1135 2.0E-18
sp|Q7A5H7|SRRB_STAAN Sensor protein SrrB OS=Staphylococcus aureus (strain N315) GN=srrB PE=1 SV=2 855 1131 4.0E-18
sp|Q99TZ9|SRRB_STAAM Sensor protein SrrB OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=srrB PE=3 SV=2 855 1131 4.0E-18
sp|Q8NWF3|SRRB_STAAW Sensor protein SrrB OS=Staphylococcus aureus (strain MW2) GN=srrB PE=3 SV=2 855 1131 4.0E-18
sp|Q6G973|SRRB_STAAS Sensor protein SrrB OS=Staphylococcus aureus (strain MSSA476) GN=srrB PE=3 SV=2 855 1131 4.0E-18
sp|Q5HFT1|SRRB_STAAC Sensor protein SrrB OS=Staphylococcus aureus (strain COL) GN=srrB PE=2 SV=1 855 1131 4.0E-18
sp|Q2FY80|SRRB_STAA8 Sensor protein SrrB OS=Staphylococcus aureus (strain NCTC 8325) GN=srrB PE=3 SV=1 855 1131 4.0E-18
sp|Q9L523|SRRB_STAAU Sensor protein SrrB OS=Staphylococcus aureus GN=srrB PE=2 SV=1 855 1131 5.0E-18
sp|Q6GGK7|SRRB_STAAR Sensor protein SrrB OS=Staphylococcus aureus (strain MRSA252) GN=srrB PE=3 SV=2 855 1131 7.0E-18
sp|A5W4E3|TODS_PSEP1 Sensor histidine kinase TodS OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todS PE=1 SV=1 748 1317 4.0E-17
sp|A1A698|OHK4_ORYSJ Probable histidine kinase 4 OS=Oryza sativa subsp. japonica GN=HK4 PE=2 SV=1 847 1133 4.0E-17
sp|E0X9C7|TODS_PSEPT Sensor histidine kinase TodS OS=Pseudomonas putida (strain DOT-T1E) GN=todS PE=1 SV=1 748 1317 6.0E-17
sp|Q9C5U1|AHK3_ARATH Histidine kinase 3 OS=Arabidopsis thaliana GN=AHK3 PE=1 SV=1 845 1133 6.0E-17
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 849 1227 7.0E-17
sp|Q9XH58|ETR1_PELHO Ethylene receptor 1 OS=Pelargonium hortorum GN=ETR1 PE=2 SV=1 849 1317 8.0E-17
sp|P59342|BARA_SHIFL Signal transduction histidine-protein kinase BarA OS=Shigella flexneri GN=barA PE=3 SV=1 801 1135 8.0E-17
sp|P0AEC5|BARA_ECOLI Signal transduction histidine-protein kinase BarA OS=Escherichia coli (strain K12) GN=barA PE=1 SV=1 801 1135 8.0E-17
sp|P0AEC6|BARA_ECOL6 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=barA PE=1 SV=1 801 1135 8.0E-17
sp|P0AEC7|BARA_ECO57 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O157:H7 GN=barA PE=3 SV=1 801 1135 8.0E-17
sp|Q9SXL4|AHK1_ARATH Histidine kinase 1 OS=Arabidopsis thaliana GN=AHK1 PE=1 SV=2 843 1135 1.0E-16
sp|Q9C5U0|AHK4_ARATH Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 PE=1 SV=1 849 1133 2.0E-16
sp|Q54RP6|DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum GN=dhkL PE=3 SV=1 708 1152 5.0E-16
sp|O48929|ETR1_TOBAC Ethylene receptor OS=Nicotiana tabacum GN=ETR1 PE=2 SV=1 849 1317 9.0E-16
sp|Q8KIY1|TMOS_PSEME Sensor histidine kinase TmoS OS=Pseudomonas mendocina GN=tmoS PE=1 SV=1 748 1317 1.0E-15
sp|O81122|ETR1_MALDO Ethylene receptor OS=Malus domestica GN=ETR1 PE=2 SV=1 849 1317 2.0E-15
sp|O82436|ETR1_CUCMN Ethylene receptor 1 OS=Cucumis melo var. cantalupensis GN=ETR1 PE=2 SV=1 849 1319 2.0E-15
sp|P30855|EVGS_ECOLI Sensor protein EvgS OS=Escherichia coli (strain K12) GN=evgS PE=1 SV=2 807 1316 2.0E-15
sp|P58402|EVGS_ECO57 Sensor protein EvgS OS=Escherichia coli O157:H7 GN=evgS PE=3 SV=1 849 1327 2.0E-15
sp|Q9C5U2|AHK2_ARATH Histidine kinase 2 OS=Arabidopsis thaliana GN=AHK2 PE=1 SV=1 849 1133 3.0E-15
sp|Q9XH57|ETR2_PELHO Ethylene receptor 2 OS=Pelargonium hortorum GN=ETR2 PE=2 SV=1 849 1309 4.0E-15
sp|Q5AHA0|CHK1_CANAL Histidine protein kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHK1 PE=2 SV=1 858 1131 5.0E-15
sp|Q41342|ETR1_SOLLC Ethylene receptor 1 OS=Solanum lycopersicum GN=ETR1 PE=1 SV=1 849 1317 5.0E-15
sp|Q869S5|DOKA_DICDI Hybrid signal transduction protein dokA OS=Dictyostelium discoideum GN=dokA PE=1 SV=1 721 1242 6.0E-15
sp|Q54SP4|DHKD_DICDI Hybrid signal transduction histidine kinase D OS=Dictyostelium discoideum GN=dhkD PE=2 SV=1 732 1135 1.0E-14
sp|Q551X9|DHKF_DICDI Hybrid signal transduction histidine kinase F OS=Dictyostelium discoideum GN=dhkF PE=3 SV=1 834 1149 3.0E-14
sp|Q8Z332|ZRAS_SALTI Sensor protein ZraS OS=Salmonella typhi GN=zraS PE=3 SV=1 840 1135 3.0E-14
sp|P37461|ZRAS_SALTY Sensor protein ZraS OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=zraS PE=2 SV=2 840 1135 3.0E-14
sp|Q5A599|NIK1_CANAL Histidine protein kinase NIK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIK1 PE=1 SV=2 1185 1323 5.0E-14
sp|Q9SSY6|ETR1_CUCSA Ethylene receptor 1 OS=Cucumis sativus GN=ETR1 PE=2 SV=1 849 1319 6.0E-14
sp|Q86AT9|DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum GN=dhkI-1 PE=3 SV=1 1187 1313 7.0E-14
sp|O49187|ETR2_SOLLC Ethylene receptor 2 OS=Solanum lycopersicum GN=ETR2 PE=2 SV=1 849 1309 1.0E-13
sp|Q54SK5|DHKM_DICDI Hybrid signal transduction histidine kinase M OS=Dictyostelium discoideum GN=dhkM PE=3 SV=1 1187 1317 1.0E-13
sp|Q54Q69|DHKG_DICDI Hybrid signal transduction histidine kinase G OS=Dictyostelium discoideum GN=dhkG PE=3 SV=1 849 1142 2.0E-13
sp|Q9P7Q7|MAK1_SCHPO Peroxide stress-activated histidine kinase mak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak1 PE=3 SV=1 1159 1309 3.0E-13
sp|P94414|YCLK_BACSU Sensor histidine kinase YclK OS=Bacillus subtilis (strain 168) GN=yclK PE=3 SV=1 823 1131 5.0E-13
sp|P0DMC5|RCSC_ECOLI Sensor histidine kinase RcsC OS=Escherichia coli (strain K12) GN=rcsC PE=1 SV=1 832 1198 1.0E-12
sp|P0DMC6|RCSC_ECOLX Sensor histidine kinase RcsC OS=Escherichia coli GN=rcsC PE=1 SV=1 832 1198 1.0E-12
sp|Q869S5|DOKA_DICDI Hybrid signal transduction protein dokA OS=Dictyostelium discoideum GN=dokA PE=1 SV=1 1176 1322 2.0E-12
sp|Q9M7M1|ETR1_PRUPE Ethylene receptor OS=Prunus persica GN=ETR1 PE=2 SV=1 849 1317 2.0E-12
sp|P58662|RCSC_SALTY Sensor histidine kinase RcsC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rcsC PE=3 SV=1 832 1135 5.0E-12
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase B OS=Dictyostelium discoideum GN=dhkB PE=1 SV=1 1169 1310 2.0E-11
sp|P35164|RESE_BACSU Sensor histidine kinase ResE OS=Bacillus subtilis (strain 168) GN=resE PE=1 SV=1 847 1139 2.0E-11
sp|P87323|MCS4_SCHPO Response regulator mcs4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcs4 PE=3 SV=1 1183 1315 2.0E-11
sp|Q9C5U0|AHK4_ARATH Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 PE=1 SV=1 1157 1304 4.0E-11
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 1186 1315 5.0E-11
sp|P49333|ETR1_ARATH Ethylene receptor 1 OS=Arabidopsis thaliana GN=ETR1 PE=1 SV=1 849 1317 6.0E-11
sp|Q54W36|DHKH_DICDI Hybrid signal transduction histidine kinase H OS=Dictyostelium discoideum GN=dhkH PE=3 SV=1 830 1008 8.0E-11
sp|Q51455|CHEY_PSEAE Chemotaxis protein CheY OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cheY PE=3 SV=1 1187 1319 8.0E-11
sp|A2YFR6|OHK1_ORYSI Probable histidine kinase 1 OS=Oryza sativa subsp. indica GN=HK1 PE=3 SV=1 1147 1303 9.0E-11
sp|P20169|DSPA_SYNY3 Drug sensory protein A OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dspA PE=3 SV=2 844 1141 9.0E-11
sp|Q9C5U2|AHK2_ARATH Histidine kinase 2 OS=Arabidopsis thaliana GN=AHK2 PE=1 SV=1 1187 1304 1.0E-10
sp|Q54Q69|DHKG_DICDI Hybrid signal transduction histidine kinase G OS=Dictyostelium discoideum GN=dhkG PE=3 SV=1 1187 1309 1.0E-10
sp|P39928|SLN1_YEAST Osmosensing histidine protein kinase SLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLN1 PE=1 SV=1 1187 1321 1.0E-10
sp|A3BE68|OHK1_ORYSJ Probable histidine kinase 1 OS=Oryza sativa subsp. japonica GN=HK1 PE=2 SV=1 1187 1303 2.0E-10
sp|P0DMC5|RCSC_ECOLI Sensor histidine kinase RcsC OS=Escherichia coli (strain K12) GN=rcsC PE=1 SV=1 1144 1303 2.0E-10
sp|Q54RP6|DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum GN=dhkL PE=3 SV=1 1184 1320 3.0E-10
sp|Q54W36|DHKH_DICDI Hybrid signal transduction histidine kinase H OS=Dictyostelium discoideum GN=dhkH PE=3 SV=1 1068 1136 4.0E-10
sp|P14375|ZRAR_ECOLI Transcriptional regulatory protein ZraR OS=Escherichia coli (strain K12) GN=zraR PE=1 SV=2 1185 1315 4.0E-10
sp|Q8X613|ZRAR_ECO57 Transcriptional regulatory protein ZraR OS=Escherichia coli O157:H7 GN=zraR PE=3 SV=1 1185 1315 5.0E-10
sp|P44578|ARCB_HAEIN Aerobic respiration control sensor protein ArcB homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=arcB PE=3 SV=1 841 1116 5.0E-10
sp|Q7A0W5|ARLS_STAAW Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MW2) GN=arlS PE=3 SV=1 858 1131 6.0E-10
sp|Q6G9E7|ARLS_STAAS Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MSSA476) GN=arlS PE=3 SV=1 858 1131 6.0E-10
sp|Q7A5N3|ARLS_STAAN Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain N315) GN=arlS PE=1 SV=1 858 1131 6.0E-10
sp|Q7A2R7|ARLS_STAAM Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=arlS PE=3 SV=1 858 1131 6.0E-10
sp|Q5HG05|ARLS_STAAC Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain COL) GN=arlS PE=3 SV=1 858 1131 6.0E-10
sp|Q9KJN3|ARLS_STAA8 Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain NCTC 8325) GN=arlS PE=1 SV=1 858 1131 6.0E-10
sp|Q2FH24|ARLS_STAA3 Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain USA300) GN=arlS PE=3 SV=1 858 1131 6.0E-10
sp|P45608|PHOR_KLEPN Phosphate regulon sensor protein PhoR OS=Klebsiella pneumoniae GN=phoR PE=3 SV=1 854 1138 6.0E-10
sp|Q6GGZ4|ARLS_STAAR Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MRSA252) GN=arlS PE=3 SV=1 858 1131 6.0E-10
sp|Q2YY04|ARLS_STAAB Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=arlS PE=3 SV=1 858 1131 6.0E-10
sp|Q95PI2|DHKC_DICDI Hybrid signal transduction histidine kinase C OS=Dictyostelium discoideum GN=dhkC PE=1 SV=1 1187 1319 6.0E-10
sp|Q07084|SSK1_YEAST Osmolarity two-component system protein SSK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK1 PE=1 SV=1 1183 1315 8.0E-10
sp|A1A699|OHK6_ORYSJ Probable histidine kinase 6 OS=Oryza sativa subsp. japonica GN=HK6 PE=1 SV=1 1186 1317 1.0E-09
sp|Q3S4A7|AHK5_ARATH Histidine kinase 5 OS=Arabidopsis thaliana GN=AHK5 PE=1 SV=1 1187 1309 1.0E-09
sp|P0DMC6|RCSC_ECOLX Sensor histidine kinase RcsC OS=Escherichia coli GN=rcsC PE=1 SV=1 1144 1303 1.0E-09
sp|A6X580|DIVK_OCHA4 Polar-differentiation response regulator DivK OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=divK PE=3 SV=1 1187 1318 1.0E-09
sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 1188 1317 2.0E-09
sp|A1A698|OHK4_ORYSJ Probable histidine kinase 4 OS=Oryza sativa subsp. japonica GN=HK4 PE=2 SV=1 1160 1318 2.0E-09
sp|Q56128|RCSC_SALTI Sensor histidine kinase RcsC OS=Salmonella typhi GN=rcsC PE=3 SV=2 1118 1321 2.0E-09
sp|P38889|SKN7_YEAST Transcription factor SKN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKN7 PE=1 SV=1 1185 1304 2.0E-09
sp|O22267|CKI1_ARATH Histidine kinase CKI1 OS=Arabidopsis thaliana GN=CKI1 PE=1 SV=1 912 1144 2.0E-09
sp|Q54U87|DHKA_DICDI Hybrid signal transduction histidine kinase A OS=Dictyostelium discoideum GN=dhkA PE=1 SV=1 1188 1320 3.0E-09
sp|P58662|RCSC_SALTY Sensor histidine kinase RcsC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rcsC PE=3 SV=1 1118 1309 3.0E-09
sp|Q55E44|DHKE_DICDI Hybrid signal transduction histidine kinase E OS=Dictyostelium discoideum GN=dhkE PE=3 SV=1 1067 1131 3.0E-09
sp|Q8FW53|DIVK_BRUSU Polar-differentiation response regulator DivK OS=Brucella suis biovar 1 (strain 1330) GN=divK PE=3 SV=1 1187 1318 4.0E-09
sp|A9WYT1|DIVK_BRUSI Polar-differentiation response regulator DivK OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=divK PE=3 SV=1 1187 1318 4.0E-09
sp|A5VUU3|DIVK_BRUO2 Polar-differentiation response regulator DivK OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=divK PE=3 SV=2 1187 1318 4.0E-09
sp|Q8YC73|DIVK_BRUME Polar-differentiation response regulator DivK OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=divK PE=3 SV=1 1187 1318 4.0E-09
sp|A9MBQ2|DIVK_BRUC2 Polar-differentiation response regulator DivK OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=divK PE=3 SV=1 1187 1318 4.0E-09
sp|Q7BBW0|DIVK_BRUAB Polar-differentiation response regulator DivK OS=Brucella abortus biovar 1 (strain 9-941) GN=divK PE=1 SV=1 1187 1318 4.0E-09
sp|Q2YKN1|DIVK_BRUA2 Polar-differentiation response regulator DivK OS=Brucella abortus (strain 2308) GN=divK PE=3 SV=1 1187 1318 4.0E-09
sp|B2SB45|DIVK_BRUA1 Polar-differentiation response regulator DivK OS=Brucella abortus (strain S19) GN=divK PE=3 SV=1 1187 1318 4.0E-09
sp|Q7BWI3|SASA_PROMA Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=sasA PE=3 SV=1 989 1143 4.0E-09
sp|Q9HWR3|BPHY_PSEAE Bacteriophytochrome OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bphP PE=1 SV=1 841 1121 6.0E-09
sp|Q9C5U1|AHK3_ARATH Histidine kinase 3 OS=Arabidopsis thaliana GN=AHK3 PE=1 SV=1 1187 1313 7.0E-09
sp|O74539|MAK3_SCHPO Peroxide stress-activated histidine kinase mak3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak3 PE=1 SV=1 1187 1313 8.0E-09
sp|Q5A872|SLN1_CANAL Histidine protein kinase SLN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLN1 PE=1 SV=1 1187 1304 2.0E-08
sp|Q8Z333|ZRAR_SALTI Transcriptional regulatory protein ZraR OS=Salmonella typhi GN=zraR PE=3 SV=1 1185 1321 2.0E-08
sp|P25852|ZRAR_SALTY Transcriptional regulatory protein ZraR OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=zraR PE=1 SV=2 1185 1321 2.0E-08
sp|Q9APD9|ZRAR_KLEOX Transcriptional regulatory protein ZraR OS=Klebsiella oxytoca GN=zraR PE=3 SV=1 1186 1321 3.0E-08
sp|P51586|YSO1_LEPBY Uncharacterized 14.6 kDa protein in sodA1 3'region OS=Leptolyngbya boryana PE=3 SV=1 1185 1315 3.0E-08
sp|P08400|PHOR_ECOLI Phosphate regulon sensor protein PhoR OS=Escherichia coli (strain K12) GN=phoR PE=1 SV=1 854 1138 5.0E-08
sp|P18540|VIRA_AGRFC Wide host range VirA protein OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=virA PE=3 SV=2 847 1152 5.0E-08
sp|A1W0A5|CHEY_CAMJJ Chemotaxis protein CheY homolog OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=cheY PE=3 SV=1 1187 1318 5.0E-08
sp|P0C635|CHEY_CAMJE Chemotaxis protein CheY homolog OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=cheY PE=3 SV=1 1187 1318 5.0E-08
sp|A8FMH1|CHEY_CAMJ8 Chemotaxis protein CheY homolog OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=cheY PE=3 SV=1 1187 1318 5.0E-08
sp|Q93CB7|MTRB_MYCPA Sensor histidine kinase MtrB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mtrB PE=3 SV=1 854 1135 6.0E-08
sp|P71403|CHEY_HELPY Chemotaxis protein CheY homolog OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=cheY PE=1 SV=2 1187 1318 6.0E-08
sp|Q9ZM64|CHEY_HELPJ Chemotaxis protein CheY homolog OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=cheY PE=3 SV=1 1187 1318 6.0E-08
sp|Q86AT9|DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum GN=dhkI-1 PE=3 SV=1 804 1007 1.0E-07
sp|Q5A4X5|SKN7_CANAL Transcription factor SKN7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SKN7 PE=3 SV=1 1168 1304 2.0E-07
sp|A1A696|OHK3_ORYSJ Probable histidine kinase 3 OS=Oryza sativa subsp. japonica GN=HK3 PE=2 SV=1 1187 1313 2.0E-07
sp|A2WYI4|OHK3_ORYSI Probable histidine kinase 3 OS=Oryza sativa subsp. indica GN=HK3 PE=2 SV=1 1187 1313 2.0E-07
sp|P45609|PHOR_SHIDY Phosphate regulon sensor protein PhoR OS=Shigella dysenteriae GN=phoR PE=3 SV=1 854 1138 2.0E-07
sp|A7MRY4|LUXN_VIBCB Autoinducer 1 sensor kinase/phosphatase LuxN OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=luxN PE=1 SV=1 857 1322 2.0E-07
sp|P0C5S6|LUXN_VIBHA Autoinducer 1 sensor kinase/phosphatase LuxN OS=Vibrio harveyi GN=luxN PE=3 SV=1 857 1322 2.0E-07
sp|Q75KW7|ORR41_ORYSJ Two-component response regulator ORR41 OS=Oryza sativa subsp. japonica GN=RR41 PE=3 SV=1 1181 1309 2.0E-07
sp|Q5AHA0|CHK1_CANAL Histidine protein kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHK1 PE=2 SV=1 1187 1323 3.0E-07
sp|Q5SML4|OHK2_ORYSJ Probable histidine kinase 2 OS=Oryza sativa subsp. japonica GN=HK2 PE=2 SV=1 1187 1304 3.0E-07
sp|A2YA15|OHK2_ORYSI Probable histidine kinase 2 OS=Oryza sativa subsp. indica GN=HK2 PE=3 SV=1 1187 1304 3.0E-07
sp|Q5AKU6|SSK1_CANAL Oxidative stress response two-component system protein SSK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSK1 PE=1 SV=1 1183 1315 3.0E-07
sp|P39928|SLN1_YEAST Osmosensing histidine protein kinase SLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLN1 PE=1 SV=1 1064 1183 4.0E-07
sp|A5VRX4|PDHS_BRUO2 Cell-division control histidine kinase PdhS OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=pdhS PE=3 SV=1 826 1129 4.0E-07
sp|P9WGK8|MTRB_MYCTO Sensor histidine kinase MtrB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mtrB PE=3 SV=1 854 1135 4.0E-07
sp|P59963|MTRB_MYCBO Sensor histidine kinase MtrB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mtrB PE=3 SV=1 854 1135 4.0E-07
sp|P9WGK9|MTRB_MYCTU Sensor histidine kinase MtrB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mtrB PE=1 SV=1 854 1135 4.0E-07
sp|Q551X9|DHKF_DICDI Hybrid signal transduction histidine kinase F OS=Dictyostelium discoideum GN=dhkF PE=3 SV=1 1187 1320 5.0E-07
sp|Q9M8Y4|ARR22_ARATH Two-component response regulator ARR22 OS=Arabidopsis thaliana GN=ARR22 PE=2 SV=1 1163 1316 6.0E-07
sp|P48027|GACS_PSESY Sensor protein GacS OS=Pseudomonas syringae pv. syringae GN=gacS PE=3 SV=1 1166 1325 1.0E-06
sp|Q9KM66|CQSS_VIBCH CAI-1 autoinducer sensor kinase/phosphatase CqsS OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cqsS PE=1 SV=1 1187 1303 1.0E-06
sp|Q9CCJ1|MTRB_MYCLE Sensor histidine kinase MtrB OS=Mycobacterium leprae (strain TN) GN=mtrB PE=3 SV=1 854 1135 1.0E-06
sp|P9WGM3|PDTAR_MYCTU Probable transcriptional regulatory protein pdtaR OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pdtaR PE=1 SV=1 1187 1328 1.0E-06
sp|P9WGM2|PDTAR_MYCTO Probable transcriptional regulatory protein pdtaR OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pdtaR PE=3 SV=1 1187 1328 1.0E-06
sp|A0QTK3|MTRB_MYCS2 Sensor histidine kinase MtrB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mtrB PE=3 SV=2 854 1135 2.0E-06
sp|A1TEL7|MPRA_MYCVP Response regulator MprA OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=mprA PE=3 SV=1 1187 1319 2.0E-06
sp|P06628|SP0F_BACSU Sporulation initiation phosphotransferase F OS=Bacillus subtilis (strain 168) GN=spo0F PE=1 SV=1 1187 1315 2.0E-06
sp|Q6K9T0|ORR3_ORYSJ Two-component response regulator ORR3 OS=Oryza sativa subsp. japonica GN=RR3 PE=2 SV=1 1182 1305 2.0E-06
sp|Q4GZK8|ORR3_ORYSI Two-component response regulator ORR3 OS=Oryza sativa subsp. indica GN=RR3 PE=2 SV=1 1182 1305 2.0E-06
sp|A1A697|OHK5_ORYSJ Probable histidine kinase 5 OS=Oryza sativa subsp. japonica GN=HK5 PE=2 SV=1 1186 1317 3.0E-06
sp|Q49VK3|GRAR_STAS1 Response regulator protein GraR OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=graR PE=3 SV=1 1186 1319 4.0E-06
sp|Q1XDE4|YCF29_PYRYE Probable transcriptional regulator ycf29 OS=Pyropia yezoensis GN=ycf29 PE=3 SV=1 1185 1319 5.0E-06
sp|P59342|BARA_SHIFL Signal transduction histidine-protein kinase BarA OS=Shigella flexneri GN=barA PE=3 SV=1 1187 1304 6.0E-06
sp|A7N6S2|CQSS_VIBCB CAI-1 autoinducer sensor kinase/phosphatase CqsS OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cqsS PE=1 SV=1 1187 1313 6.0E-06
sp|Q8Z7H2|PHOP_SALTI Virulence transcriptional regulatory protein PhoP OS=Salmonella typhi GN=phoP PE=3 SV=1 1184 1324 6.0E-06
sp|P0DM78|PHOP_SALTY Virulence transcriptional regulatory protein PhoP OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=phoP PE=1 SV=1 1184 1324 7.0E-06
sp|F5ZP95|PHOP_SALTU Virulence transcriptional regulatory protein PhoP OS=Salmonella typhimurium (strain ATCC 68169 / UK-1) GN=phoP PE=1 SV=1 1184 1324 7.0E-06
sp|E1WFA1|PHOP_SALTS Virulence transcriptional regulatory protein PhoP OS=Salmonella typhimurium (strain SL1344) GN=phoP PE=2 SV=1 1184 1324 7.0E-06
sp|D0ZV90|PHOP_SALT1 Virulence transcriptional regulatory protein PhoP OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=phoP PE=1 SV=1 1184 1324 7.0E-06
sp|Q5PMJ1|PHOP_SALPA Virulence transcriptional regulatory protein PhoP OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=phoP PE=3 SV=1 1184 1324 7.0E-06
sp|Q2QXY3|ORR10_ORYSJ Two-component response regulator ORR10 OS=Oryza sativa subsp. japonica GN=RR10 PE=2 SV=2 1185 1309 7.0E-06
sp|B8BLZ4|ORR10_ORYSI Two-component response regulator ORR10 OS=Oryza sativa subsp. indica GN=RR10 PE=2 SV=1 1185 1309 7.0E-06
sp|Q06065|ATOC_ECOLI Acetoacetate metabolism regulatory protein AtoC OS=Escherichia coli (strain K12) GN=atoC PE=3 SV=2 1187 1309 7.0E-06
sp|P0AEC5|BARA_ECOLI Signal transduction histidine-protein kinase BarA OS=Escherichia coli (strain K12) GN=barA PE=1 SV=1 1187 1304 8.0E-06
sp|P0AEC6|BARA_ECOL6 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=barA PE=1 SV=1 1187 1304 8.0E-06
sp|P0AEC7|BARA_ECO57 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O157:H7 GN=barA PE=3 SV=1 1187 1304 8.0E-06
sp|P06218|NTRB_KLEOX Nitrogen regulation protein NtrB OS=Klebsiella oxytoca GN=ntrB PE=3 SV=1 846 1139 8.0E-06
sp|Q9ZWS7|ARR7_ARATH Two-component response regulator ARR7 OS=Arabidopsis thaliana GN=ARR7 PE=1 SV=1 1183 1319 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000160 phosphorelay signal transduction system Yes
GO:0007165 signal transduction Yes
GO:0000155 phosphorelay sensor kinase activity Yes
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0140299 small molecule sensor activity No
GO:0016775 phosphotransferase activity, nitrogenous group as acceptor No
GO:0016301 kinase activity No
GO:0016740 transferase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0050789 regulation of biological process No
GO:0004673 protein histidine kinase activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No
GO:0004672 protein kinase activity No
GO:0035556 intracellular signal transduction No
GO:0065007 biological regulation No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3767
MDQAPAKKPRTLASPPRRFEMPSSVSIPSQFLPSSNDGTFSSSPLFFSHTPPRPLGRPTNSAPPDVTAGMLSRAR
DDAAAITTVKLPRGSVCSSPAMTGSSLSSSLDLSLPTLSPDGRSLPVTLQRVQSIGAIEFVEHDERPTFLVDLSN
PPDVKQSGLNILYYNGALRSCADIYALLSADNQNTISQAFDRFKAWAYHPHVSDSSVPFPTHHQYGGTDWTSTTL
RQRFRFISANTTANASRPRLSRPSSVESVPSAVAESPLGQSMPITPEGDNSDPPDYFGDAATAALKPGLAPTLND
IAIETKFGDDRRHPDDFTNQVLQLQPTKSVFDWTRIPITDTLPEHIKFAKSVDWASTPLGPMSEWTSDLRAMSNL
IMGSPHPAAMYWGPDLICIYNAAYIELAGQKHPSLMGMSYKDGWPEIWSEIEPIFKSATECGQAMMKHDNRLFLH
RHGFLEETFFSWAIVPLVGTEGEVVGLYNPAFEHTLRRINDRRMLTLREIGERTAAATTVSGFWPQVQRGLEYNE
NDVPFSLIYSIKEETESEVSSLQSGSFMHSPQVVLEGSPGVPEGHAAAPPYLDLRTSDEGFAPYMRQCMQGGSEP
LVLSASDDSLPKHLIEGIEGRGFGDACTNVVIFPVVPTTKEAATGFIVLGLNPRRPYDDNYKLFIHLLSRQLATS
MASVVLFEEEIRRGQRAARLAALDRQELSMQLLLRTQEANESEYRFTRMAEYAPVGMFIADCHGRINYCNDMWWQ
ISRHSRFDETELAWMNSVRDEDRPPLEEAWRKLLRDRVTISVEFRFNHSQQRGVNTIDTWVLMSAFPEKNSDGVL
KSIFGCITDISSQKWAEKVQSERREEAVELKRQQENFIDITSHEMRNPLSAVLQCADQISNNIVTFSAHRDPAQL
ETFLESCLDAANTINLCASHQKRIVDDILTLSKLDSNLLAVTPVDEQPVKAVQRALKMFESELQAHDIELEFSVD
DSFERHGVEWAKLDPSRLRQVLINLMTNAIKFTQGRDKRRIVVSLSASKDISEVTSKGVLYFDRNDGPRMTNMDI
DNEADWGAGERINIHCSVEDTGPGLAEEELKVLFQRFQQATPRTHVKYGGSGLGLFISRILTEMQGGQIGVTSAR
GKGSKFNFYIQSRKSLDPPSGYERISPFRIARKTQAPAAAAPSSTQATRSATGKDGQPLFDVLIVEDNIVNQKVL
QRQLRSWGNNTFVANHGREALQTLEKSRFWAGQEAEGVDISVILMDLEMPVMDGMTCARRIRELEREGTIVKHIP
IIAVTAYARPEQIEDAKAAGIDDVISKPFRIPELMPKIEELVGRWRNLAVPAGA*
Coding >Ophun1|3767
ATGGACCAGGCCCCCGCCAAGAAGCCCCGGACCTTGGCCTCGCCGCCCCGCCGCTTCGAGATGCCGTCCTCAGTC
TCGATTCCTTCCCAATTCCTGCCGTCGTCCAATGATGGGACCTTTTCGTCTTCGCCTCTCTTCTTCTCCCATACG
CCCCCGAGGCCGCTCGGCCGCCCGACGAACTCGGCCCCCCCGGACGTGACGGCCGGCATGCTGTCCCGCGCTCGT
GATGACGCAGCCGCCATTACCACCGTCAAGCTACCTCGCGGCAGCGTCTGCTCTAGTCCAGCCATGACGGGCAGC
AGCCTGAGTTCCTCGCTCGACTTGTCGCTTCCCACCCTGAGCCCCGATGGCCGCAGCCTACCCGTCACCTTGCAA
AGGGTTCAGAGCATCGGCGCCATCGAGTTCGTCGAGCACGACGAGCGACCGACCTTTCTCGTCGATCTCTCGAAC
CCCCCGGATGTGAAACAGTCAGGGCTCAACATTCTGTATTACAACGGCGCCCTGCGATCTTGCGCTGACATCTAC
GCCTTGCTCTCCGCCGACAACCAGAACACTATTTCTCAAGCCTTCGATCGGTTCAAGGCCTGGGCCTACCATCCT
CATGTCAGCGACTCATCCGTTCCGTTCCCTACCCATCATCAGTATGGCGGCACCGACTGGACCTCCACGACGTTG
CGCCAGAGGTTCCGCTTCATCAGCGCCAATACCACGGCAAACGCCTCTCGGCCTCGCCTCTCTCGGCCTTCTTCC
GTCGAATCGGTTCCCTCTGCAGTGGCTGAATCTCCTCTCGGCCAGTCCATGCCAATCACTCCTGAAGGGGACAAC
TCGGACCCTCCCGACTATTTTGGCGATGCTGCCACCGCGGCCCTCAAGCCTGGCCTTGCCCCGACCCTCAACGAT
ATAGCAATCGAGACGAAATTCGGCGACGATCGGCGGCATCCGGACGACTTCACCAACCAGGTGCTGCAGCTGCAG
CCTACTAAATCCGTCTTCGACTGGACCAGGATACCCATCACCGACACCCTCCCCGAGCACATCAAGTTCGCCAAG
TCGGTCGATTGGGCCTCGACGCCCCTGGGGCCAATGTCGGAATGGACGAGCGACCTGAGAGCCATGTCGAACCTG
ATCATGGGCAGCCCTCACCCTGCCGCTATGTATTGGGGTCCCGATCTGATTTGCATATACAACGCCGCATATATT
GAGCTTGCCGGGCAAAAGCATCCCTCGCTCATGGGCATGTCGTATAAAGACGGCTGGCCTGAGATCTGGAGCGAG
ATTGAACCGATATTCAAGAGTGCGACGGAATGCGGTCAGGCCATGATGAAACACGACAACCGACTCTTTCTCCAT
CGTCACGGTTTCCTCGAGGAGACGTTCTTCTCCTGGGCCATCGTGCCCCTGGTCGGGACCGAGGGTGAGGTGGTT
GGCCTGTACAATCCCGCCTTTGAGCACACTCTACGTCGGATCAACGACCGTCGGATGCTGACGCTGCGAGAGATT
GGGGAGAGGACAGCCGCGGCGACGACGGTGAGCGGCTTCTGGCCCCAGGTGCAGAGGGGCCTCGAGTACAACGAG
AACGACGTCCCGTTCAGCCTCATCTACTCAATCAAGGAGGAAACGGAGAGCGAGGTGTCGTCTCTGCAATCGGGC
AGCTTCATGCACTCACCGCAGGTTGTGCTCGAGGGCTCACCCGGCGTGCCCGAGGGACATGCTGCTGCCCCCCCT
TATCTGGACTTGAGGACGTCGGATGAGGGCTTCGCGCCCTACATGCGGCAGTGCATGCAGGGAGGCAGCGAGCCA
TTGGTGCTGTCTGCGAGCGATGACTCTCTTCCGAAGCACCTCATCGAGGGCATTGAAGGACGAGGCTTCGGCGAT
GCTTGCACCAACGTTGTCATCTTTCCCGTCGTGCCCACGACCAAAGAGGCAGCCACCGGCTTCATTGTGCTGGGT
CTAAATCCTCGGCGACCCTACGACGACAACTACAAGCTCTTCATCCATCTCCTCTCTCGGCAGTTGGCGACGTCG
ATGGCCTCGGTGGTGCTCTTCGAGGAGGAGATTCGTCGAGGACAGCGGGCGGCGCGACTGGCCGCTCTGGATCGT
CAGGAGCTGTCGATGCAGCTCCTATTGCGGACGCAGGAAGCCAACGAGAGCGAGTATCGGTTCACGCGCATGGCC
GAGTACGCGCCGGTGGGCATGTTCATCGCCGACTGTCACGGTCGTATCAACTACTGCAACGACATGTGGTGGCAG
ATCTCGCGTCACTCCCGTTTCGACGAGACGGAACTCGCGTGGATGAATAGCGTCAGAGACGAGGATCGACCGCCG
CTGGAGGAGGCGTGGCGGAAGCTGCTCCGGGACCGCGTCACCATCTCGGTCGAGTTTCGCTTCAACCACAGCCAG
CAGAGGGGCGTCAACACCATCGACACCTGGGTTCTCATGAGCGCCTTTCCCGAGAAGAATTCCGACGGCGTGCTC
AAGTCCATCTTTGGCTGTATCACTGACATCTCGTCTCAGAAGTGGGCTGAGAAGGTGCAGAGCGAGAGGAGGGAA
GAGGCCGTCGAGCTCAAGCGCCAGCAGGAGAACTTTATTGACATCACCAGCCACGAGATGCGCAACCCGCTGTCA
GCCGTCCTGCAGTGCGCCGATCAAATATCCAACAACATCGTCACCTTTTCCGCGCACAGGGACCCGGCCCAGCTG
GAGACGTTCCTCGAGAGCTGCCTGGACGCGGCCAACACCATCAATCTCTGTGCCAGTCACCAGAAACGCATCGTC
GACGACATCCTCACCCTGTCCAAGCTCGACTCCAACCTCCTAGCCGTCACTCCGGTCGACGAGCAGCCGGTCAAG
GCGGTGCAGCGCGCGCTCAAGATGTTCGAATCGGAGCTGCAGGCCCACGACATTGAGCTCGAGTTCAGCGTCGAC
GACAGCTTCGAGAGGCACGGCGTCGAGTGGGCCAAGCTCGATCCGTCGAGGCTGCGGCAGGTCCTGATTAACCTG
ATGACCAACGCCATCAAGTTCACACAGGGCCGCGACAAGCGCAGGATCGTCGTCTCCCTGTCGGCGTCCAAGGAC
ATCTCCGAGGTCACCAGCAAGGGCGTGCTCTATTTTGACCGCAACGACGGCCCCCGCATGACGAATATGGACATC
GACAACGAGGCTGACTGGGGCGCTGGCGAACGCATCAACATACACTGCTCGGTGGAGGATACGGGGCCGGGGCTG
GCCGAAGAGGAGCTCAAGGTGCTGTTCCAGCGTTTCCAACAGGCGACGCCCCGCACGCACGTCAAGTACGGCGGC
TCCGGCTTGGGGCTGTTCATCTCGAGGATCTTGACCGAGATGCAGGGCGGGCAGATTGGCGTCACGTCGGCCAGG
GGCAAGGGCAGCAAGTTCAACTTTTACATCCAGAGCCGCAAGAGCCTGGACCCTCCATCCGGCTACGAACGCATC
TCGCCCTTCCGCATCGCTCGGAAGACACAGGCTCCGGCGGCGGCCGCGCCGAGCAGCACGCAGGCCACCCGCAGC
GCCACGGGCAAAGACGGGCAGCCGCTGTTCGACGTGCTCATCGTCGAGGATAACATTGTCAACCAAAAGGTGCTT
CAAAGGCAGCTGCGCAGCTGGGGAAACAACACGTTTGTGGCCAACCACGGCCGCGAGGCTCTCCAGACGTTGGAG
AAGTCGAGGTTCTGGGCCGGGCAGGAGGCCGAGGGCGTCGACATCTCCGTCATCCTCATGGACCTGGAGATGCCC
GTCATGGACGGAATGACGTGCGCCCGGCGGATCCGTGAACTCGAGAGGGAGGGAACGATTGTGAAGCACATACCC
ATAATTGCCGTCACGGCCTATGCGCGTCCCGAGCAGATTGAGGACGCCAAGGCCGCTGGTATCGACGACGTCATC
TCGAAGCCGTTTCGCATCCCGGAGTTGATGCCCAAGATTGAGGAGCTGGTAGGCAGGTGGCGAAACCTAGCCGTC
CCAGCCGGAGCGTGA
Transcript >Ophun1|3767
ATGGACCAGGCCCCCGCCAAGAAGCCCCGGACCTTGGCCTCGCCGCCCCGCCGCTTCGAGATGCCGTCCTCAGTC
TCGATTCCTTCCCAATTCCTGCCGTCGTCCAATGATGGGACCTTTTCGTCTTCGCCTCTCTTCTTCTCCCATACG
CCCCCGAGGCCGCTCGGCCGCCCGACGAACTCGGCCCCCCCGGACGTGACGGCCGGCATGCTGTCCCGCGCTCGT
GATGACGCAGCCGCCATTACCACCGTCAAGCTACCTCGCGGCAGCGTCTGCTCTAGTCCAGCCATGACGGGCAGC
AGCCTGAGTTCCTCGCTCGACTTGTCGCTTCCCACCCTGAGCCCCGATGGCCGCAGCCTACCCGTCACCTTGCAA
AGGGTTCAGAGCATCGGCGCCATCGAGTTCGTCGAGCACGACGAGCGACCGACCTTTCTCGTCGATCTCTCGAAC
CCCCCGGATGTGAAACAGTCAGGGCTCAACATTCTGTATTACAACGGCGCCCTGCGATCTTGCGCTGACATCTAC
GCCTTGCTCTCCGCCGACAACCAGAACACTATTTCTCAAGCCTTCGATCGGTTCAAGGCCTGGGCCTACCATCCT
CATGTCAGCGACTCATCCGTTCCGTTCCCTACCCATCATCAGTATGGCGGCACCGACTGGACCTCCACGACGTTG
CGCCAGAGGTTCCGCTTCATCAGCGCCAATACCACGGCAAACGCCTCTCGGCCTCGCCTCTCTCGGCCTTCTTCC
GTCGAATCGGTTCCCTCTGCAGTGGCTGAATCTCCTCTCGGCCAGTCCATGCCAATCACTCCTGAAGGGGACAAC
TCGGACCCTCCCGACTATTTTGGCGATGCTGCCACCGCGGCCCTCAAGCCTGGCCTTGCCCCGACCCTCAACGAT
ATAGCAATCGAGACGAAATTCGGCGACGATCGGCGGCATCCGGACGACTTCACCAACCAGGTGCTGCAGCTGCAG
CCTACTAAATCCGTCTTCGACTGGACCAGGATACCCATCACCGACACCCTCCCCGAGCACATCAAGTTCGCCAAG
TCGGTCGATTGGGCCTCGACGCCCCTGGGGCCAATGTCGGAATGGACGAGCGACCTGAGAGCCATGTCGAACCTG
ATCATGGGCAGCCCTCACCCTGCCGCTATGTATTGGGGTCCCGATCTGATTTGCATATACAACGCCGCATATATT
GAGCTTGCCGGGCAAAAGCATCCCTCGCTCATGGGCATGTCGTATAAAGACGGCTGGCCTGAGATCTGGAGCGAG
ATTGAACCGATATTCAAGAGTGCGACGGAATGCGGTCAGGCCATGATGAAACACGACAACCGACTCTTTCTCCAT
CGTCACGGTTTCCTCGAGGAGACGTTCTTCTCCTGGGCCATCGTGCCCCTGGTCGGGACCGAGGGTGAGGTGGTT
GGCCTGTACAATCCCGCCTTTGAGCACACTCTACGTCGGATCAACGACCGTCGGATGCTGACGCTGCGAGAGATT
GGGGAGAGGACAGCCGCGGCGACGACGGTGAGCGGCTTCTGGCCCCAGGTGCAGAGGGGCCTCGAGTACAACGAG
AACGACGTCCCGTTCAGCCTCATCTACTCAATCAAGGAGGAAACGGAGAGCGAGGTGTCGTCTCTGCAATCGGGC
AGCTTCATGCACTCACCGCAGGTTGTGCTCGAGGGCTCACCCGGCGTGCCCGAGGGACATGCTGCTGCCCCCCCT
TATCTGGACTTGAGGACGTCGGATGAGGGCTTCGCGCCCTACATGCGGCAGTGCATGCAGGGAGGCAGCGAGCCA
TTGGTGCTGTCTGCGAGCGATGACTCTCTTCCGAAGCACCTCATCGAGGGCATTGAAGGACGAGGCTTCGGCGAT
GCTTGCACCAACGTTGTCATCTTTCCCGTCGTGCCCACGACCAAAGAGGCAGCCACCGGCTTCATTGTGCTGGGT
CTAAATCCTCGGCGACCCTACGACGACAACTACAAGCTCTTCATCCATCTCCTCTCTCGGCAGTTGGCGACGTCG
ATGGCCTCGGTGGTGCTCTTCGAGGAGGAGATTCGTCGAGGACAGCGGGCGGCGCGACTGGCCGCTCTGGATCGT
CAGGAGCTGTCGATGCAGCTCCTATTGCGGACGCAGGAAGCCAACGAGAGCGAGTATCGGTTCACGCGCATGGCC
GAGTACGCGCCGGTGGGCATGTTCATCGCCGACTGTCACGGTCGTATCAACTACTGCAACGACATGTGGTGGCAG
ATCTCGCGTCACTCCCGTTTCGACGAGACGGAACTCGCGTGGATGAATAGCGTCAGAGACGAGGATCGACCGCCG
CTGGAGGAGGCGTGGCGGAAGCTGCTCCGGGACCGCGTCACCATCTCGGTCGAGTTTCGCTTCAACCACAGCCAG
CAGAGGGGCGTCAACACCATCGACACCTGGGTTCTCATGAGCGCCTTTCCCGAGAAGAATTCCGACGGCGTGCTC
AAGTCCATCTTTGGCTGTATCACTGACATCTCGTCTCAGAAGTGGGCTGAGAAGGTGCAGAGCGAGAGGAGGGAA
GAGGCCGTCGAGCTCAAGCGCCAGCAGGAGAACTTTATTGACATCACCAGCCACGAGATGCGCAACCCGCTGTCA
GCCGTCCTGCAGTGCGCCGATCAAATATCCAACAACATCGTCACCTTTTCCGCGCACAGGGACCCGGCCCAGCTG
GAGACGTTCCTCGAGAGCTGCCTGGACGCGGCCAACACCATCAATCTCTGTGCCAGTCACCAGAAACGCATCGTC
GACGACATCCTCACCCTGTCCAAGCTCGACTCCAACCTCCTAGCCGTCACTCCGGTCGACGAGCAGCCGGTCAAG
GCGGTGCAGCGCGCGCTCAAGATGTTCGAATCGGAGCTGCAGGCCCACGACATTGAGCTCGAGTTCAGCGTCGAC
GACAGCTTCGAGAGGCACGGCGTCGAGTGGGCCAAGCTCGATCCGTCGAGGCTGCGGCAGGTCCTGATTAACCTG
ATGACCAACGCCATCAAGTTCACACAGGGCCGCGACAAGCGCAGGATCGTCGTCTCCCTGTCGGCGTCCAAGGAC
ATCTCCGAGGTCACCAGCAAGGGCGTGCTCTATTTTGACCGCAACGACGGCCCCCGCATGACGAATATGGACATC
GACAACGAGGCTGACTGGGGCGCTGGCGAACGCATCAACATACACTGCTCGGTGGAGGATACGGGGCCGGGGCTG
GCCGAAGAGGAGCTCAAGGTGCTGTTCCAGCGTTTCCAACAGGCGACGCCCCGCACGCACGTCAAGTACGGCGGC
TCCGGCTTGGGGCTGTTCATCTCGAGGATCTTGACCGAGATGCAGGGCGGGCAGATTGGCGTCACGTCGGCCAGG
GGCAAGGGCAGCAAGTTCAACTTTTACATCCAGAGCCGCAAGAGCCTGGACCCTCCATCCGGCTACGAACGCATC
TCGCCCTTCCGCATCGCTCGGAAGACACAGGCTCCGGCGGCGGCCGCGCCGAGCAGCACGCAGGCCACCCGCAGC
GCCACGGGCAAAGACGGGCAGCCGCTGTTCGACGTGCTCATCGTCGAGGATAACATTGTCAACCAAAAGGTGCTT
CAAAGGCAGCTGCGCAGCTGGGGAAACAACACGTTTGTGGCCAACCACGGCCGCGAGGCTCTCCAGACGTTGGAG
AAGTCGAGGTTCTGGGCCGGGCAGGAGGCCGAGGGCGTCGACATCTCCGTCATCCTCATGGACCTGGAGATGCCC
GTCATGGACGGAATGACGTGCGCCCGGCGGATCCGTGAACTCGAGAGGGAGGGAACGATTGTGAAGCACATACCC
ATAATTGCCGTCACGGCCTATGCGCGTCCCGAGCAGATTGAGGACGCCAAGGCCGCTGGTATCGACGACGTCATC
TCGAAGCCGTTTCGCATCCCGGAGTTGATGCCCAAGATTGAGGAGCTGGTAGGCAGGTGGCGAAACCTAGCCGTC
CCAGCCGGAGCGTGA
Gene >Ophun1|3767
ATGGACCAGGCCCCCGCCAAGAAGCCCCGGACCTTGGCCTCGCCGCCCCGCCGCTTCGAGATGCCGTCCTCAGTC
TCGATTCCTTCCCAATTCCTGCCGTCGTCCAATGATGGGACCTTTTCGTCTTCGCCTCTCTTCTTCTCCCATACG
CCCCCGAGGCCGCTCGGCCGCCCGACGAACTCGGCCCCCCCGGACGTGACGGCCGGCATGCTGTCCCGCGCTCGT
GATGACGCAGCCGCCATTACCACCGTCAAGCTACCTCGCGGCAGCGTCTGCTCTAGTCCAGCCATGACGGGCAGC
AGCCTGAGTTCCTCGCTCGACTTGTCGCTTCCCACCCTGAGCCCCGATGGCCGCAGCCTACCCGTCACCTTGCAA
AGGGTTCAGAGCATCGGCGCCATCGAGTTCGTCGAGCACGACGAGCGACCGACCTTTCTCGTCGATCTCTCGAAC
CCCCCGGATGTGAAACAGTCAGGGCTCAACATTCTGTATTACAACGGCGCCCTGCGATCTTGCGCTGACATCTAC
GCCTTGCTCTCCGCCGACAACCAGAACACTATTTCTCAAGCCTTCGATCGGTTCAAGGCCTGGGCCTACCATCCT
CATGTCAGCGACTCATCCGTTCCGTTCCCTACCCATCATCAGTATGGCGGCACCGACTGGACCTCCACGACGTTG
CGCCAGAGGTTCCGCTTCATCAGCGCCAATACCACGGCAAACGCCTCTCGGCCTCGCCTCTCTCGGCCTTCTTCC
GTCGAATCGGTTCCCTCTGCAGTGGCTGAATCTCCTCTCGGCCAGTCCATGCCAATCACTCCTGAAGGGGACAAC
TCGGACCCTCCCGACTATTTTGGCGATGCTGCCACCGCGGCCCTCAAGCCTGGCCTTGCCCCGACCCTCAACGAT
ATAGCAATCGAGACGAAATTCGGCGACGATCGGCGGCATCCGGACGACTTCACCAACCAGGTGCTGCAGCTGCAG
CCTACTAAATCCGTCTTCGACTGGACCAGGATACCCATCACCGACACCCTCCCCGAGCACATCAAGTTCGCCAAG
TCGGTCGATTGGGCCTCGACGCCCCTGGGGCCAATGTCGGAATGGACGAGCGACCTGAGAGCCATGTCGAACCTG
ATCATGGGCAGCCCTCACCCTGCCGCTATGTATTGGGGTCCCGATCTGATTTGCATATACAACGCCGCATATATT
GAGCTTGCCGGGCAAAAGCATCCCTCGCTCATGGGCATGTCGTATAAAGACGGCTGGCCTGAGATCTGGAGCGAG
ATTGAACCGATATTCAAGAGTGCGACGGAATGCGGTCAGGCCATGATGAAACACGACAACCGACTCTTTCTCCAT
CGTCACGGTTTCCTCGAGGAGACGTTCTTCTCCTGGGCCATCGTGCCCCTGGTCGGGACCGAGGGTGAGGTGGTT
GGCCTGTACAATCCCGCCTTTGAGCACACTCTACGTCGGATCAACGACCGTCGGATGCTGACGCTGCGAGAGATT
GGGGAGAGGACAGCCGCGGCGACGACGGTGAGCGGCTTCTGGCCCCAGGTGCAGAGGGGCCTCGAGTACAACGAG
AACGACGTCCCGTTCAGCCTCATCTACTCAATCAAGGAGGAAACGGAGAGCGAGGTGTCGTCTCTGCAATCGGGC
AGCTTCATGCACTCACCGCAGGTTGTGCTCGAGGGCTCACCCGGCGTGCCCGAGGGACATGCTGCTGCCCCCCCT
TATCTGGACTTGAGGACGTCGGATGAGGGCTTCGCGCCCTACATGCGGCAGTGCATGCAGGGAGGCAGCGAGCCA
TTGGTGCTGTCTGCGAGCGATGACTCTCTTCCGAAGCACCTCATCGAGGGCATTGAAGGACGAGGCTTCGGCGAT
GCTTGCACCAACGTTGTCATCTTTCCCGTCGTGCCCACGACCAAAGAGGCAGCCACCGGCTTCATTGTGCTGGGT
CTAAATCCTCGGCGACCCTACGACGACAACTACAAGCTCTTCATCCATCTCCTCTCTCGGCAGTTGGCGACGTCG
ATGGCCTCGGTGGTGCTCTTCGAGGAGGAGATTCGTCGAGGACAGCGGGCGGCGCGACTGGCCGCTCTGGATCGT
CAGGAGCTGTCGATGCAGCTCCTATTGCGGACGCAGGAAGCCAACGAGAGCGAGTATCGGTTCACGCGCATGGCC
GAGTACGCGCCGGTGGGCATGTTCATCGCCGACTGTCACGGTCGTATCAACTACTGCAACGACATGTGGTGGCAG
ATCTCGCGTCACTCCCGTTTCGACGAGACGGAACTCGCGTGGATGAATAGCGTCAGAGACGAGGATCGACCGCCG
CTGGAGGAGGCGTGGCGGAAGCTGCTCCGGGACCGCGTCACCATCTCGGTCGAGTTTCGCTTCAACCACAGCCAG
CAGAGGGGCGTCAACACCATCGACACCTGGGTTCTCATGAGCGCCTTTCCCGAGAAGAATTCCGACGGCGTGCTC
AAGTCCATCTTTGGCTGTATCACTGACATCTCGTCTCAGAAGTGGGCTGAGAAGGTGCAGAGCGAGAGGAGGGAA
GAGGCCGTCGAGCTCAAGCGCCAGCAGGAGAACTTTATTGACATCACCAGCCACGAGATGCGCAACCCGCTGTCA
GCCGTCCTGCAGTGCGCCGATCAAATATCCAACAACATCGTCACCTTTTCCGCGCACAGGGACCCGGCCCAGCTG
GAGACGTTCCTCGAGAGCTGCCTGGACGCGGCCAACACCATCAATCTCTGTGCCAGTCACCAGAAACGCATCGTC
GACGACATCCTCACCCTGTCCAAGCTCGACTCCAACCTCCTAGCCGTCACTCCGGTCGACGAGCAGCCGGTCAAG
GCGGTGCAGCGCGCGCTCAAGATGTTCGAATCGGAGCTGCAGGCCCACGACATTGAGCTCGAGTTCAGCGTCGAC
GACAGCTTCGAGAGGCACGGCGTCGAGTGGGCCAAGCTCGATCCGTCGAGGCTGCGGCAGGTCCTGATTAACCTG
ATGACCAACGCCATCAAGTTCACACAGGGCCGCGACAAGCGCAGGATCGTCGTCTCCCTGTCGGCGTCCAAGGAC
ATCTCCGAGGTCACCAGCAAGGGCGTGCTCTATTTTGACCGCAACGACGGCCCCCGCATGACGAATATGGACATC
GACAACGAGGCTGACTGGGGCGCTGGCGAACGCATCAACATACACTGCTCGGTGGAGGATACGGGGCCGGGGCTG
GCCGAAGAGGAGCTCAAGGTGCTGTTCCAGCGTTTCCAACAGGCGACGCCCCGCACGCACGTCAAGTACGGCGGC
TCCGGCTTGGGGCTGTTCATCTCGAGGATCTTGACCGAGATGCAGGGCGGGCAGATTGGCGTCACGTCGGCCAGG
GGCAAGGGCAGCAAGTTCAACTTTTACATCCAGAGCCGCAAGAGCCTGGACCCTCCATCCGGCTACGAACGCATC
TCGCCCTTCCGCATCGCTCGGAAGACACAGGCTCCGGCGGCGGCCGCGCCGAGCAGCACGCAGGCCACCCGCAGC
GCCACGGGCAAAGACGGGCAGCCGCTGTTCGACGTGCTCATCGTCGAGGATAACATTGTCAACCAAAAGGTGCTT
CAAAGGCAGCTGCGCAGCTGGGGAAACAACACGTTTGTGGCCAACCACGGCCGCGAGGCTCTCCAGACGTTGGAG
AAGTCGAGGTTCTGGGCCGGGCAGGAGGCCGAGGGCGTCGACATCTCCGTCATCCTCATGGACCTGGAGATGCCC
GTCATGGACGGAATGACGTGCGCCCGGCGGATCCGTGAACTCGAGAGGGAGGGAACGATTGTGAAGCACATACCC
ATAATTGCCGTCACGGCCTATGCGCGTCCCGAGCAGATTGAGGACGCCAAGGCCGCTGGTATCGTGAGTTTTCTC
TGCGTGATGCATCTGTTGTGAGGAAGGCTACTGACGGGCGAGGCAGGACGACGTCATCTCGAAGCCGTTTCGCAT
CCCGGAGTTGATGCCCAAGATTGAGGAGCTGGTAGGCAGGTGGCGAAACCTAGCCGTCCCAGCCGGAGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail