Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3763
Gene name
LocationContig_339:3204..4780
Strand+
Gene length (bp)1576
Transcript length (bp)1503
Coding sequence length (bp)1503
Protein length (aa) 501

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01704 UDPGP UTP--glucose-1-phosphate uridylyltransferase 7.0E-59 73 435

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74933|UAP1_CANAX UDP-N-acetylglucosamine pyrophosphorylase OS=Candida albicans GN=UAP1 PE=1 SV=1 21 488 3.0E-162
sp|P43123|UAP1_YEAST UDP-N-acetylglucosamine pyrophosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QRI1 PE=1 SV=1 25 497 6.0E-149
sp|Q16222|UAP1_HUMAN UDP-N-acetylhexosamine pyrophosphorylase OS=Homo sapiens GN=UAP1 PE=1 SV=3 25 498 5.0E-138
sp|Q91YN5|UAP1_MOUSE UDP-N-acetylhexosamine pyrophosphorylase OS=Mus musculus GN=Uap1 PE=1 SV=1 25 498 3.0E-137
sp|Q28CH3|UAP1L_XENTR UDP-N-acetylhexosamine pyrophosphorylase-like protein 1 OS=Xenopus tropicalis GN=uap1l1 PE=2 SV=1 23 498 2.0E-134
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74933|UAP1_CANAX UDP-N-acetylglucosamine pyrophosphorylase OS=Candida albicans GN=UAP1 PE=1 SV=1 21 488 3.0E-162
sp|P43123|UAP1_YEAST UDP-N-acetylglucosamine pyrophosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QRI1 PE=1 SV=1 25 497 6.0E-149
sp|Q16222|UAP1_HUMAN UDP-N-acetylhexosamine pyrophosphorylase OS=Homo sapiens GN=UAP1 PE=1 SV=3 25 498 5.0E-138
sp|Q91YN5|UAP1_MOUSE UDP-N-acetylhexosamine pyrophosphorylase OS=Mus musculus GN=Uap1 PE=1 SV=1 25 498 3.0E-137
sp|Q28CH3|UAP1L_XENTR UDP-N-acetylhexosamine pyrophosphorylase-like protein 1 OS=Xenopus tropicalis GN=uap1l1 PE=2 SV=1 23 498 2.0E-134
sp|Q7ZWD4|UAP1L_DANRE UDP-N-acetylhexosamine pyrophosphorylase-like protein 1 OS=Danio rerio GN=uap1l1 PE=2 SV=1 24 498 6.0E-126
sp|O64765|UAP2_ARATH UDP-N-acetylglucosamine diphosphorylase 2 OS=Arabidopsis thaliana GN=GLCNAC1PUT2 PE=1 SV=1 28 495 3.0E-124
sp|Q3KQV9|UAP1L_HUMAN UDP-N-acetylhexosamine pyrophosphorylase-like protein 1 OS=Homo sapiens GN=UAP1L1 PE=1 SV=2 26 498 2.0E-122
sp|Q3TW96|UAP1L_MOUSE UDP-N-acetylhexosamine pyrophosphorylase-like protein 1 OS=Mus musculus GN=Uap1l1 PE=1 SV=1 88 500 7.0E-119
sp|Q940S3|UAP1_ARATH UDP-N-acetylglucosamine diphosphorylase 1 OS=Arabidopsis thaliana GN=GLCNAC1PUT1 PE=1 SV=1 28 495 2.0E-118
sp|O94617|UAP1_SCHPO Probable UDP-N-acetylglucosamine pyrophosphorylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uap1 PE=1 SV=1 109 492 1.0E-111
sp|Q54GN5|UAP1_DICDI Probable UDP-N-acetylglucosamine pyrophosphorylase OS=Dictyostelium discoideum GN=uap1 PE=3 SV=1 27 494 4.0E-105
sp|Q18493|UAP1_CAEEL Probable UDP-N-acetylglucosamine pyrophosphorylase OS=Caenorhabditis elegans GN=C36A4.4 PE=3 SV=2 18 496 7.0E-87
sp|Q49ZB5|URTF_STAS1 Probable uridylyltransferase SSP0716 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0716 PE=3 SV=1 29 445 1.0E-70
sp|Q5HE34|URTF_STAAC Probable uridylyltransferase SACOL2161 OS=Staphylococcus aureus (strain COL) GN=SACOL2161 PE=3 SV=1 29 438 4.0E-68
sp|Q2FW81|URTF_STAA8 Probable uridylyltransferase SAOUHSC_02423 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02423 PE=3 SV=1 29 438 4.0E-68
sp|Q2FEW1|URTF_STAA3 Probable uridylyltransferase SAUSA300_2130 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2130 PE=3 SV=1 29 438 4.0E-68
sp|Q7A0A0|URTF_STAAW Probable uridylyltransferase MW2097 OS=Staphylococcus aureus (strain MW2) GN=MW2097 PE=3 SV=1 29 438 2.0E-67
sp|Q6G7E3|URTF_STAAS Probable uridylyltransferase SAS2072 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2072 PE=3 SV=1 29 438 2.0E-67
sp|Q7A4A4|URTF_STAAN Probable uridylyltransferase SA1974 OS=Staphylococcus aureus (strain N315) GN=SA1974 PE=1 SV=1 29 438 2.0E-67
sp|Q99S95|URTF_STAAM Probable uridylyltransferase SAV2171 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2171 PE=3 SV=1 29 438 2.0E-67
sp|Q6GEQ8|URTF_STAAR Probable uridylyltransferase SAR2262 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2262 PE=3 SV=1 29 438 5.0E-67
sp|Q2YYH4|URTF_STAAB Probable uridylyltransferase SAB2052c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB2052c PE=3 SV=1 29 438 1.0E-66
sp|Q4L846|URTF_STAHJ Probable uridylyltransferase SH0870 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0870 PE=3 SV=1 110 445 6.0E-64
sp|Q5HM59|URTF_STAEQ Probable uridylyltransferase SERP1770 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1770 PE=3 SV=1 29 438 2.0E-63
sp|Q8CNG6|URTF_STAES Probable uridylyltransferase SE_1761 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1761 PE=3 SV=1 29 438 9.0E-63
sp|Q8SQS1|UAP1_ENCCU Probable UDP-N-acetylglucosamine pyrophosphorylase OS=Encephalitozoon cuniculi (strain GB-M1) GN=UAP1 PE=1 SV=1 110 444 2.0E-46
sp|Q09WE7|USP1_SOYBN UDP-sugar pyrophosphorylase 1 OS=Glycine max GN=USP1 PE=1 SV=1 10 329 2.0E-23
sp|Q5W915|USP_PEA UDP-sugar pyrophospharylase OS=Pisum sativum GN=USP PE=1 SV=1 10 329 4.0E-21
sp|Q0GZS3|USP_CUCME UDP-sugar pyrophosphorylase OS=Cucumis melo GN=USP PE=1 SV=1 27 329 5.0E-21
sp|A2YGP6|USP_ORYSI UDP-sugar pyrophosphorylase OS=Oryza sativa subsp. indica GN=USP PE=3 SV=2 36 329 3.0E-20
sp|Q5Z8Y4|USP_ORYSJ UDP-sugar pyrophosphorylase OS=Oryza sativa subsp. japonica GN=USP PE=2 SV=1 36 329 3.0E-20
sp|Q9C5I1|USP_ARATH UDP-sugar pyrophosphorylase OS=Arabidopsis thaliana GN=USP PE=1 SV=1 27 329 1.0E-17
sp|Q54YZ0|UGPA2_DICDI UTP--glucose-1-phosphate uridylyltransferase 2 OS=Dictyostelium discoideum GN=ugpB PE=2 SV=1 122 364 5.0E-10
sp|O35156|UGPA_CRIGR UTP--glucose-1-phosphate uridylyltransferase OS=Cricetulus griseus GN=UGP2 PE=2 SV=3 121 358 5.0E-09
sp|Q91ZJ5|UGPA_MOUSE UTP--glucose-1-phosphate uridylyltransferase OS=Mus musculus GN=Ugp2 PE=1 SV=3 121 358 2.0E-08
sp|P78811|UGPA1_SCHPO Probable UTP--glucose-1-phosphate uridylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fyu1 PE=1 SV=2 121 402 2.0E-08
sp|Q16851|UGPA_HUMAN UTP--glucose-1-phosphate uridylyltransferase OS=Homo sapiens GN=UGP2 PE=1 SV=5 121 358 3.0E-08
sp|Q07130|UGPA_BOVIN UTP--glucose-1-phosphate uridylyltransferase OS=Bos taurus GN=UGP2 PE=1 SV=2 121 358 8.0E-08
sp|P08800|UGPA1_DICDI UTP--glucose-1-phosphate uridylyltransferase 1 OS=Dictyostelium discoideum GN=uppA PE=2 SV=2 121 421 2.0E-07
sp|O59819|UGPA2_SCHPO Probable UTP--glucose-1-phosphate uridylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.10 PE=3 SV=1 121 328 5.0E-07
sp|Q8SSC5|UGPA1_ENCCU UTP--glucose-1-phosphate uridylyltransferase OS=Encephalitozoon cuniculi (strain GB-M1) GN=UGP1 PE=1 SV=1 122 353 6.0E-07
sp|P79303|UGPA_PIG UTP--glucose-1-phosphate uridylyltransferase OS=Sus scrofa GN=UGP2 PE=2 SV=3 121 276 7.0E-07
sp|Q9SDX3|UGPA_MUSAC UTP--glucose-1-phosphate uridylyltransferase OS=Musa acuminata GN=UGPA PE=2 SV=1 86 404 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0070569 uridylyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016779 nucleotidyltransferase activity No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3763
MDKAKELLHLGSKSAGRSPPTDEAVSELKEKYARAGQEQVFAFWDSLSGDERAELFDQLEGFDPGRIDGIAKRAL
EGSAVEKKATDSLEPLPESATASVLDSGADKIDAWYKAGLKLIAENKVAVVLMAGGQGTRLGSSDPKGCFDIGLP
SRKSLFQIQAERIRKVQELAAASSGSSNVMVPWYVMTSGPTRKPTQEFLDKHDYFGLDRANVQIFEQGVLPCLSP
QGKMLLESKGRVAVAPDGNGGIYQALVLSGVLEDMRRRGVEHIHAYCVDNCLVRVADPVFIGFAASKDVDIATKV
VRKRNATESVGLILCRDGKPDVVEYSEMDKAMAEATDAKQPDLLKFRAANIVNHYYSFRFLESIPQWAHKLPHHV
ARKKIPSADAKTGKTVKPETPNGIKLEQFVFDVFPFLPLDKFACIEVRRDDEFSPLKNAPGKDEDDPVTSKRDIM
AQGRRWLQDAGATVVAEGGVEVSPLISYGGEGLDKVKGTTITAPAVLERE*
Coding >Ophun1|3763
ATGGACAAGGCTAAGGAATTGCTTCACCTGGGCTCCAAGTCCGCGGGCCGATCGCCGCCCACCGACGAGGCCGTA
TCGGAGCTCAAGGAAAAGTACGCCCGCGCGGGACAGGAGCAAGTCTTTGCCTTCTGGGACTCGCTTTCTGGTGAT
GAGCGTGCCGAGCTGTTTGATCAGCTTGAGGGATTCGATCCTGGACGCATTGATGGCATTGCCAAGCGTGCTCTC
GAGGGCAGTGCCGTGGAGAAGAAGGCTACGGATTCGTTGGAGCCGCTCCCCGAGTCGGCCACGGCCAGCGTCCTT
GATTCCGGCGCCGACAAGATCGACGCCTGGTACAAGGCTGGCTTGAAGCTCATCGCCGAGAATAAAGTCGCTGTC
GTTCTCATGGCCGGCGGTCAGGGCACGCGTCTCGGCAGCTCCGATCCAAAGGGCTGCTTCGACATTGGCCTTCCC
TCGCGCAAGTCGCTCTTCCAGATCCAGGCGGAACGCATCCGAAAGGTGCAAGAGTTGGCGGCTGCTAGCAGCGGC
TCGTCCAACGTCATGGTGCCGTGGTACGTCATGACGAGCGGTCCGACGAGGAAGCCTACGCAAGAGTTCCTCGAC
AAGCACGACTACTTCGGCCTCGATCGAGCAAATGTTCAGATCTTTGAGCAGGGCGTCTTGCCGTGTCTGTCGCCT
CAGGGGAAGATGCTTCTCGAGAGCAAGGGACGCGTTGCCGTTGCGCCGGACGGCAACGGCGGCATCTATCAGGCT
CTCGTCCTCTCTGGCGTCCTCGAAGATATGCGTCGCCGTGGTGTCGAGCACATACACGCCTACTGCGTAGACAAC
TGTCTGGTCCGCGTCGCCGACCCCGTCTTCATTGGCTTCGCAGCCTCAAAGGACGTCGACATCGCGACAAAGGTG
GTACGCAAGCGCAACGCCACCGAATCCGTCGGCCTCATCCTCTGCCGCGACGGAAAGCCCGATGTGGTCGAGTAC
TCGGAGATGGACAAGGCCATGGCCGAGGCCACGGACGCCAAGCAGCCCGACCTCCTCAAGTTCCGAGCCGCCAAC
ATCGTCAACCACTACTACTCATTCCGCTTCCTCGAGTCCATCCCCCAGTGGGCCCACAAGCTTCCTCACCACGTC
GCCCGCAAGAAGATCCCATCCGCCGACGCAAAGACGGGAAAGACGGTCAAGCCCGAGACGCCCAACGGCATCAAG
CTCGAGCAGTTCGTCTTCGACGTCTTTCCCTTCCTGCCGCTCGACAAGTTCGCCTGCATCGAGGTCCGTCGCGAC
GATGAGTTCTCGCCGCTTAAGAACGCGCCTGGAAAGGACGAGGATGATCCCGTTACCAGCAAGCGTGATATCATG
GCCCAGGGCCGTCGATGGCTTCAGGATGCGGGCGCCACCGTTGTGGCCGAGGGGGGCGTCGAGGTCTCGCCTCTC
ATCAGCTACGGCGGCGAGGGTCTGGACAAGGTTAAGGGAACCACTATTACCGCCCCAGCCGTCCTGGAGCGGGAA
TAA
Transcript >Ophun1|3763
ATGGACAAGGCTAAGGAATTGCTTCACCTGGGCTCCAAGTCCGCGGGCCGATCGCCGCCCACCGACGAGGCCGTA
TCGGAGCTCAAGGAAAAGTACGCCCGCGCGGGACAGGAGCAAGTCTTTGCCTTCTGGGACTCGCTTTCTGGTGAT
GAGCGTGCCGAGCTGTTTGATCAGCTTGAGGGATTCGATCCTGGACGCATTGATGGCATTGCCAAGCGTGCTCTC
GAGGGCAGTGCCGTGGAGAAGAAGGCTACGGATTCGTTGGAGCCGCTCCCCGAGTCGGCCACGGCCAGCGTCCTT
GATTCCGGCGCCGACAAGATCGACGCCTGGTACAAGGCTGGCTTGAAGCTCATCGCCGAGAATAAAGTCGCTGTC
GTTCTCATGGCCGGCGGTCAGGGCACGCGTCTCGGCAGCTCCGATCCAAAGGGCTGCTTCGACATTGGCCTTCCC
TCGCGCAAGTCGCTCTTCCAGATCCAGGCGGAACGCATCCGAAAGGTGCAAGAGTTGGCGGCTGCTAGCAGCGGC
TCGTCCAACGTCATGGTGCCGTGGTACGTCATGACGAGCGGTCCGACGAGGAAGCCTACGCAAGAGTTCCTCGAC
AAGCACGACTACTTCGGCCTCGATCGAGCAAATGTTCAGATCTTTGAGCAGGGCGTCTTGCCGTGTCTGTCGCCT
CAGGGGAAGATGCTTCTCGAGAGCAAGGGACGCGTTGCCGTTGCGCCGGACGGCAACGGCGGCATCTATCAGGCT
CTCGTCCTCTCTGGCGTCCTCGAAGATATGCGTCGCCGTGGTGTCGAGCACATACACGCCTACTGCGTAGACAAC
TGTCTGGTCCGCGTCGCCGACCCCGTCTTCATTGGCTTCGCAGCCTCAAAGGACGTCGACATCGCGACAAAGGTG
GTACGCAAGCGCAACGCCACCGAATCCGTCGGCCTCATCCTCTGCCGCGACGGAAAGCCCGATGTGGTCGAGTAC
TCGGAGATGGACAAGGCCATGGCCGAGGCCACGGACGCCAAGCAGCCCGACCTCCTCAAGTTCCGAGCCGCCAAC
ATCGTCAACCACTACTACTCATTCCGCTTCCTCGAGTCCATCCCCCAGTGGGCCCACAAGCTTCCTCACCACGTC
GCCCGCAAGAAGATCCCATCCGCCGACGCAAAGACGGGAAAGACGGTCAAGCCCGAGACGCCCAACGGCATCAAG
CTCGAGCAGTTCGTCTTCGACGTCTTTCCCTTCCTGCCGCTCGACAAGTTCGCCTGCATCGAGGTCCGTCGCGAC
GATGAGTTCTCGCCGCTTAAGAACGCGCCTGGAAAGGACGAGGATGATCCCGTTACCAGCAAGCGTGATATCATG
GCCCAGGGCCGTCGATGGCTTCAGGATGCGGGCGCCACCGTTGTGGCCGAGGGGGGCGTCGAGGTCTCGCCTCTC
ATCAGCTACGGCGGCGAGGGTCTGGACAAGGTTAAGGGAACCACTATTACCGCCCCAGCCGTCCTGGAGCGGGAA
TAA
Gene >Ophun1|3763
ATGGACAAGGCTAAGGAATTGCTTCACCTGGGCTCCAAGTCCGCGGGCCGATCGCCGCCCACCGACGAGGCCGTA
TCGGAGCTCAAGGAAAAGTACGCCCGCGCGGGACAGGAGCAAGTCTTTGCCTTCTGGGACTCGCTTTCTGGTGAT
GAGCGTGCCGAGCTGTTTGATCAGCTTGAGGGATTCGATCCTGGACGCATTGATGGCATTGCCAAGCGTGCTCTC
GAGGGCAGTGCCGTGGAGAAGAAGGCTACGGATTCGTTGGAGCCGCTCCCCGAGTCGGCCACGGCCAGCGTCCTT
GATTCCGGCGCCGACAAGATCGACGCCTGGTACAAGGCTGGCTTGAAGCTCATCGCCGAGAATAAAGTCGCTGTC
GTTCTCATGGCCGGCGGTCAGGGCACGCGTCTCGGCAGCTCCGATCCAAAGGGCTGCTTCGACATTGGCCTTCCC
TCGCGCAAGTCGCTCTTCCAGATCCAGGCGGAACGCATCCGAAAGGTGCAAGAGTTGGCGGCTGCTAGCAGCGGC
TCGTCCAACGTCATGGTGCCGTGGTACGTCATGACGAGCGGTCCGACGAGGAAGCCTACGCAAGAGTTCCTCGAC
AAGCACGACTACTTCGGCCTCGATCGAGCAAATGTTCAGATCTTTGAGCAGGGCGTCTTGCCGTGTCTGTCGCCT
CAGGGGAAGATGCTTCTCGAGAGCAAGGGACGCGTTGCCGTTGCGCCGGACGGCAACGGCGGCATCTATCAGGCT
CTCGTCCTCTCTGGCGTCCTCGAAGATATGCGTCGCCGTGGTGTCGAGCACATACACGCCTACTGCGTAGACAAC
TGTCTGGTCCGCGTCGCCGACCCCGTCTTCATTGGCTTCGCAGCCTCAAAGGACGTCGACATCGCGACAAAGGTG
GTACGCAAGCGCAACGCCACCGAATCCGTCGGCCTCATCCTCTGCCGCGACGGAAAGCCCGATGTGGTCGAGTAC
TCGGAGATGGACAAGGCCATGGCCGAGGCCACGGACGCCAAGCAGCCCGACCTCCTCAAGTTCCGAGCCGCCAAC
ATCGTCAACCACTACTACTCATTCCGCTTCCTCGAGTCCATCCCCCAGTGGGCCCACAAGCTTCCTCACCACGTC
GCCCGCAAGAAGATCCCATCCGCCGACGCAAAGACGGGAAAGACGGTCAAGCCCGAGACGCCCAACGGCATCAAG
CTCGAGCAGTTCGTCTTCGACGTCTTTCCCTTCCTGCCGCTCGACAAGTTCGCCTGCATCGAGGTCCGTCGCGAC
GATGAGTTCTCGCCGCTTAAGAACGCGCCTGGAAAGGACGAGGATGATCCCGTTACCAGCAAGCGTGATATCATG
GCCCAGGGCCGTCGATGGCTTCAGGATGCGGGCGCCACCGTTGTGGCCGAGGGGGGCGTCGAGGTCTCGCCTCTC
ATCAGCTACGTGAGTCTTCGACCCCCTCCTGAATTCTTCTTCATCTTGCCCCCTGCTCTAACCGCGTACGTCTCA
ATCACAGGGCGGCGAGGGTCTGGACAAGGTTAAGGGAACCACTATTACCGCCCCAGCCGTCCTGGAGCGGGAATA
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail