Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3755
Gene name
LocationContig_338:2962..4658
Strand+
Gene length (bp)1696
Transcript length (bp)1515
Coding sequence length (bp)1515
Protein length (aa) 505

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 2.0E-23 61 196

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 45 497 8.0E-38
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 40 497 8.0E-32
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 53 229 1.0E-17
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 1 323 1.0E-12
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 6 229 5.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 45 497 8.0E-38
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 40 497 8.0E-32
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 53 229 1.0E-17
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 1 323 1.0E-12
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 6 229 5.0E-10
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 52 231 9.0E-10
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 14 223 5.0E-09
sp|Q8LNV6|CKX3_ORYSJ Cytokinin dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=CKX3 PE=2 SV=1 61 229 6.0E-09
sp|A6P6W1|CASL2_CANSA Cannabidiolic acid synthase-like 2 OS=Cannabis sativa GN=CBDAS3 PE=2 SV=1 6 231 7.0E-09
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 52 218 8.0E-09
sp|A3AVP1|CKX8_ORYSJ Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. japonica GN=CKX8 PE=3 SV=1 61 223 2.0E-08
sp|A2XVN3|CKX8_ORYSI Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. indica GN=CKX8 PE=3 SV=1 61 223 2.0E-08
sp|O22213|CKX1_ARATH Cytokinin dehydrogenase 1 OS=Arabidopsis thaliana GN=CKX1 PE=1 SV=1 10 224 3.0E-08
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 40 336 3.0E-08
sp|Q75K78|CKX9_ORYSJ Cytokinin dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CKX9 PE=2 SV=1 57 223 1.0E-07
sp|Q9FZC7|FOX4_ARATH Flavin-dependent oxidoreductase FOX4 OS=Arabidopsis thaliana GN=FOX4 PE=2 SV=1 52 243 2.0E-07
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 44 262 2.0E-07
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 61 221 7.0E-07
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 52 229 2.0E-06
sp|Q7SGY1|ALO_NEUCR Putative D-arabinono-1,4-lactone oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alo-1 PE=3 SV=1 49 225 3.0E-06
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 42 219 3.0E-06
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 72 209 4.0E-06
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 61 225 4.0E-06
sp|Q67YU0|CKX5_ARATH Cytokinin dehydrogenase 5 OS=Arabidopsis thaliana GN=CKX5 PE=2 SV=1 60 224 4.0E-06
sp|Q9SVG4|RETOL_ARATH Reticuline oxidase-like protein OS=Arabidopsis thaliana GN=At4g20830 PE=1 SV=2 51 208 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3755
MKRLHVILALASASSVTTATPAAEPCNTLAHELPTLFHGPISPEYDGLVQARWSGTSVLKPACIITPASANDVSR
TMQIITRHRCRFAVKGGGHNANPGANSIADGVSIDLRRMDSANLARDRSYVSLGAGLTWGRAYDMFNNSRVGFPG
GVCEGVGVGGVSLGGGQSLFQAKKGWVVDNIVQYELVLASGKVVTASPHRRADLFKALKGGNTNFGIVTRVNIAA
FDFPGLWSGQVIASLDHGPSNRSAMLDSVSHAMVDFVADNNRDVDSEVQLAVSYLRNNSGQVASAAISNVADVAN
PPSLRRFTDLPNRVSFIGRHGKIADFTHQLSQFQPIGFRQVTAGVTITNDFDTLRRIWDASDEVYNSLPQKDKID
WIVVLFPQPVVQQSYSKKRGGNSLGLSNNKDDQIVVWLASRWSDPSLDGMMEQARRDFIKATVAVAKKNKKYSPF
IYANYAAPDQDPLCGYGAESVAFLKRTAKKYDPNGVFQKLMPGGFKISKANCRG*
Coding >Ophun1|3755
ATGAAGCGTCTTCATGTCATCCTGGCCCTGGCCTCTGCTAGTTCCGTCACGACGGCTACCCCTGCTGCAGAGCCA
TGCAATACTCTCGCCCACGAACTACCAACCCTCTTCCACGGCCCCATCTCTCCCGAGTACGATGGCCTCGTCCAA
GCCCGCTGGTCAGGAACATCGGTGCTCAAACCAGCGTGTATCATAACGCCCGCGTCAGCCAACGATGTCTCACGA
ACGATGCAGATCATAACGCGGCACCGATGCCGCTTCGCCGTCAAGGGGGGCGGTCACAACGCCAACCCGGGGGCC
AACAGCATTGCTGACGGCGTCTCCATCGATCTCCGGCGGATGGACTCTGCGAATCTAGCTCGGGATAGGTCGTAT
GTGAGTCTCGGCGCTGGCTTGACCTGGGGCCGGGCCTATGATATGTTCAACAACAGTCGTGTTGGCTTCCCTGGC
GGTGTGTGCGAAGGCGTCGGCGTAGGAGGCGTCTCCCTCGGAGGAGGACAGTCGTTATTCCAAGCAAAGAAAGGC
TGGGTGGTCGACAACATCGTCCAATATGAACTTGTCCTAGCATCAGGCAAGGTCGTAACAGCCTCCCCTCACCGC
AGAGCAGACCTCTTCAAAGCCCTCAAAGGCGGAAACACAAACTTCGGCATCGTCACCCGCGTCAACATCGCCGCC
TTCGACTTCCCAGGCCTATGGAGCGGCCAAGTCATCGCCAGCCTCGACCACGGCCCCAGCAACCGCTCCGCCATG
CTGGACAGCGTCAGCCACGCCATGGTCGACTTCGTGGCGGATAACAACCGCGACGTTGACTCTGAGGTGCAGCTT
GCTGTTAGCTATCTGCGGAATAACAGCGGTCAGGTTGCCAGCGCGGCGATTTCGAATGTTGCGGATGTGGCGAAT
CCGCCTTCGTTACGGCGGTTTACTGACTTGCCTAATCGGGTTTCCTTTATTGGGAGGCATGGGAAGATTGCGGAC
TTTACCCATCAGCTGAGCCAGTTTCAGCCGATTGGATTCCGCCAAGTCACCGCGGGCGTCACCATTACAAACGAC
TTTGACACTCTCCGTCGTATCTGGGATGCCTCGGATGAAGTATACAACTCTCTCCCACAGAAGGATAAAATCGAC
TGGATCGTCGTCCTCTTCCCCCAGCCCGTCGTTCAGCAATCGTATTCCAAGAAGCGAGGCGGCAACAGCCTCGGC
CTCTCCAACAACAAAGACGACCAGATCGTCGTCTGGCTGGCCTCTCGCTGGTCGGACCCCAGCCTCGACGGCATG
ATGGAACAGGCTCGACGAGACTTCATCAAGGCTACCGTGGCGGTAGCCAAGAAGAATAAGAAATACTCACCCTTT
ATCTACGCCAACTACGCCGCTCCCGACCAGGATCCTCTCTGCGGCTACGGCGCCGAGTCGGTGGCTTTTTTGAAG
CGGACTGCTAAGAAGTACGATCCGAACGGTGTTTTCCAGAAGCTGATGCCGGGAGGCTTCAAGATTAGCAAGGCC
AATTGCCGTGGGTAG
Transcript >Ophun1|3755
ATGAAGCGTCTTCATGTCATCCTGGCCCTGGCCTCTGCTAGTTCCGTCACGACGGCTACCCCTGCTGCAGAGCCA
TGCAATACTCTCGCCCACGAACTACCAACCCTCTTCCACGGCCCCATCTCTCCCGAGTACGATGGCCTCGTCCAA
GCCCGCTGGTCAGGAACATCGGTGCTCAAACCAGCGTGTATCATAACGCCCGCGTCAGCCAACGATGTCTCACGA
ACGATGCAGATCATAACGCGGCACCGATGCCGCTTCGCCGTCAAGGGGGGCGGTCACAACGCCAACCCGGGGGCC
AACAGCATTGCTGACGGCGTCTCCATCGATCTCCGGCGGATGGACTCTGCGAATCTAGCTCGGGATAGGTCGTAT
GTGAGTCTCGGCGCTGGCTTGACCTGGGGCCGGGCCTATGATATGTTCAACAACAGTCGTGTTGGCTTCCCTGGC
GGTGTGTGCGAAGGCGTCGGCGTAGGAGGCGTCTCCCTCGGAGGAGGACAGTCGTTATTCCAAGCAAAGAAAGGC
TGGGTGGTCGACAACATCGTCCAATATGAACTTGTCCTAGCATCAGGCAAGGTCGTAACAGCCTCCCCTCACCGC
AGAGCAGACCTCTTCAAAGCCCTCAAAGGCGGAAACACAAACTTCGGCATCGTCACCCGCGTCAACATCGCCGCC
TTCGACTTCCCAGGCCTATGGAGCGGCCAAGTCATCGCCAGCCTCGACCACGGCCCCAGCAACCGCTCCGCCATG
CTGGACAGCGTCAGCCACGCCATGGTCGACTTCGTGGCGGATAACAACCGCGACGTTGACTCTGAGGTGCAGCTT
GCTGTTAGCTATCTGCGGAATAACAGCGGTCAGGTTGCCAGCGCGGCGATTTCGAATGTTGCGGATGTGGCGAAT
CCGCCTTCGTTACGGCGGTTTACTGACTTGCCTAATCGGGTTTCCTTTATTGGGAGGCATGGGAAGATTGCGGAC
TTTACCCATCAGCTGAGCCAGTTTCAGCCGATTGGATTCCGCCAAGTCACCGCGGGCGTCACCATTACAAACGAC
TTTGACACTCTCCGTCGTATCTGGGATGCCTCGGATGAAGTATACAACTCTCTCCCACAGAAGGATAAAATCGAC
TGGATCGTCGTCCTCTTCCCCCAGCCCGTCGTTCAGCAATCGTATTCCAAGAAGCGAGGCGGCAACAGCCTCGGC
CTCTCCAACAACAAAGACGACCAGATCGTCGTCTGGCTGGCCTCTCGCTGGTCGGACCCCAGCCTCGACGGCATG
ATGGAACAGGCTCGACGAGACTTCATCAAGGCTACCGTGGCGGTAGCCAAGAAGAATAAGAAATACTCACCCTTT
ATCTACGCCAACTACGCCGCTCCCGACCAGGATCCTCTCTGCGGCTACGGCGCCGAGTCGGTGGCTTTTTTGAAG
CGGACTGCTAAGAAGTACGATCCGAACGGTGTTTTCCAGAAGCTGATGCCGGGAGGCTTCAAGATTAGCAAGGCC
AATTGCCGTGGGTAG
Gene >Ophun1|3755
ATGAAGCGTCTTCATGTCATCCTGGCCCTGGCCTCTGCTAGTTCCGTCACGACGGCTACCCCTGCTGCAGAGCCA
GTGAGCTCCGTCTGCGTAAGCACACCACGAGAGAGGAACATACTCAGGGGGGCCAGCTCTGACGAACCCTCACAG
TGCAATACTCTCGCCCACGAACTACCAACCCTCTTCCACGGCCCCATCTCTCCCGAGTACGATGGCCTCGTCCAA
GCCCGCTGGTCAGGAACATCGGTGCTCAAACCAGCGTGTATCATAACGCCCGCGTCAGCCAACGATGTCTCACGA
ACGATGCAGATCATAACGCGGCACCGATGCCGCTTCGCCGTCAAGGGGGGCGGTCACAACGCCAACCCGGGGGCC
AACAGCATTGCTGACGGCGTCTCCATCGATCTCCGGCGGATGGACTCTGCGAATCTAGCTCGGGATAGGTCGTAT
GTGAGTCTCGGCGCTGGCTTGACCTGGGGCCGGGCCTATGATATGTTCAACAACAGTCGTGTTGGCTTCCCTGGC
GGTGTGTGCGAAGGCGTCGGCGTAGGAGGCGTCTCCCTCGGAGGAGGACAGTCGTTATTCCAAGCAAAGAAAGGC
TGGGTGGTCGACAACATCGTCCAATATGAACTTGTCCTAGCATCAGGCAAGGTCGTAACAGCCTCCCCTCACCGC
AGAGCAGACCTCTTCAAAGCCCTCAAAGGCGGAAACACAAACTTCGGCATCGTCACCCGCGTCAACATCGCCGCC
TTCGACTTCCCAGGCCTATGGAGCGGCCAAGTCATCGCCAGCCTCGACCACGGCCCCAGCAACCGCTCCGCCATG
CTGGACAGCGTCAGCCACGCCATGGTCGACTTCGTGGCGGATAACAACCGCGACGTTGACTCTGAGGTGCAGCTT
GCTGTTAGCTATCTGCGGAATAACAGCGGTCAGGTTGCCAGCGCGGCGATTTCGAATGTTGCGGATGTGGCGAAT
CCGCCTTCGTTACGGCGGTTTACTGACTTGCCTAATCGGGTTTCCTTTATTGGGAGGCATGGGAAGATTGCGGAC
TTTACCCATCAGCTGAGCCAGTTTCAGCCGATTGGATTCCGGTGAGTCTTGTTGTGGCTTCTTGTCTTTCGGGTT
CTAAACAGGGGTTTAGCCAAGTCACCGCGGGCGTCACCATTACAAACGACTTTGACACTCTCCGTCGTATCTGGG
ATGCCTCGGATGAAGTATACAACTCTCTCCCACAGAAGGATAAAATCGACTGGATCGTCGTCCTCTTCCCCCAGC
CCGTCGTTCAGCAATCGTATTCCAAGAAGCGAGGCGGCAACAGCCTCGGCCTCTCCAACAACAAAGACGACCAGA
TCGGTGAGTCTCACCACATCGTGATAGCACCGCAAGACGTGTCTGACAAGTCTCCGCAGTCGTCTGGCTGGCCTC
TCGCTGGTCGGACCCCAGCCTCGACGGCATGATGGAACAGGCTCGACGAGACTTCATCAAGGCTACCGTGGCGGT
AGCCAAGAAGAATAAGAAATACTCACCCTTTATCTACGCCAACTACGCCGCTCCCGACCAGGATCCTCTCTGCGG
CTACGGCGCCGAGTCGGTGGCTTTTTTGAAGCGGACTGCTAAGAAGTACGATCCGAACGGTGTTTTCCAGAAGCT
GATGCCGGGAGGCTTCAAGATTAGCAAGGCCAATTGCCGTGGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail