Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3743
Gene name
LocationContig_336:12938..14165
Strand+
Gene length (bp)1227
Transcript length (bp)1155
Coding sequence length (bp)1155
Protein length (aa) 385

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00312 Ribosomal_S15 Ribosomal protein S15 1.1E-24 301 373

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8P7V0|RS15_XANCP 30S ribosomal protein S15 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpsO PE=3 SV=1 287 373 1.0E-11
sp|B0RRB7|RS15_XANCB 30S ribosomal protein S15 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rpsO PE=3 SV=1 287 373 1.0E-11
sp|Q4UW99|RS15_XANC8 30S ribosomal protein S15 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpsO PE=3 SV=1 287 373 1.0E-11
sp|Q5WT39|RS15_LEGPL 30S ribosomal protein S15 OS=Legionella pneumophila (strain Lens) GN=rpsO PE=3 SV=1 299 373 2.0E-11
sp|Q5ZRV7|RS15_LEGPH 30S ribosomal protein S15 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rpsO PE=3 SV=1 299 373 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8P7V0|RS15_XANCP 30S ribosomal protein S15 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpsO PE=3 SV=1 287 373 1.0E-11
sp|B0RRB7|RS15_XANCB 30S ribosomal protein S15 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rpsO PE=3 SV=1 287 373 1.0E-11
sp|Q4UW99|RS15_XANC8 30S ribosomal protein S15 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpsO PE=3 SV=1 287 373 1.0E-11
sp|Q5WT39|RS15_LEGPL 30S ribosomal protein S15 OS=Legionella pneumophila (strain Lens) GN=rpsO PE=3 SV=1 299 373 2.0E-11
sp|Q5ZRV7|RS15_LEGPH 30S ribosomal protein S15 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rpsO PE=3 SV=1 299 373 2.0E-11
sp|A5IHU4|RS15_LEGPC 30S ribosomal protein S15 OS=Legionella pneumophila (strain Corby) GN=rpsO PE=3 SV=1 299 373 2.0E-11
sp|Q5X1C6|RS15_LEGPA 30S ribosomal protein S15 OS=Legionella pneumophila (strain Paris) GN=rpsO PE=3 SV=1 299 373 2.0E-11
sp|B0UEX4|RS15_METS4 30S ribosomal protein S15 OS=Methylobacterium sp. (strain 4-46) GN=rpsO PE=3 SV=1 288 373 4.0E-11
sp|A8G910|RS15_SERP5 30S ribosomal protein S15 OS=Serratia proteamaculans (strain 568) GN=rpsO PE=3 SV=1 299 373 4.0E-11
sp|Q2KDZ9|RS15_RHIEC 30S ribosomal protein S15 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpsO PE=3 SV=1 303 373 4.0E-11
sp|B3PXD9|RS15_RHIE6 30S ribosomal protein S15 OS=Rhizobium etli (strain CIAT 652) GN=rpsO PE=3 SV=1 303 373 4.0E-11
sp|B5ZW25|RS15_RHILW 30S ribosomal protein S15 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rpsO PE=3 SV=1 303 373 5.0E-11
sp|Q8UJ54|RS15_AGRFC 30S ribosomal protein S15 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpsO PE=3 SV=1 295 373 5.0E-11
sp|Q1MN43|RS15_RHIL3 30S ribosomal protein S15 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpsO PE=3 SV=1 303 373 7.0E-11
sp|Q5GXV2|RS15_XANOR 30S ribosomal protein S15 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rpsO PE=3 SV=2 288 373 8.0E-11
sp|B2SVK0|RS15_XANOP 30S ribosomal protein S15 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rpsO PE=3 SV=1 288 373 8.0E-11
sp|Q2P0X4|RS15_XANOM 30S ribosomal protein S15 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rpsO PE=3 SV=1 288 373 8.0E-11
sp|Q3BRP8|RS15_XANC5 30S ribosomal protein S15 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rpsO PE=3 SV=1 288 373 8.0E-11
sp|Q8PJ58|RS15_XANAC 30S ribosomal protein S15 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rpsO PE=3 SV=1 288 373 8.0E-11
sp|B9JGT0|RS15_AGRRK 30S ribosomal protein S15 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rpsO PE=3 SV=1 303 373 9.0E-11
sp|C6DKK6|RS15_PECCP 30S ribosomal protein S15 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|Q3YX76|RS15_SHISS 30S ribosomal protein S15 OS=Shigella sonnei (strain Ss046) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|P0ADZ6|RS15_SHIFL 30S ribosomal protein S15 OS=Shigella flexneri GN=rpsO PE=3 SV=2 299 373 1.0E-10
sp|Q0T0B6|RS15_SHIF8 30S ribosomal protein S15 OS=Shigella flexneri serotype 5b (strain 8401) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|Q32BG8|RS15_SHIDS 30S ribosomal protein S15 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|Q31W44|RS15_SHIBS 30S ribosomal protein S15 OS=Shigella boydii serotype 4 (strain Sb227) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|B2U210|RS15_SHIB3 30S ribosomal protein S15 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|B7LR34|RS15_ESCF3 30S ribosomal protein S15 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|Q1R6H3|RS15_ECOUT 30S ribosomal protein S15 OS=Escherichia coli (strain UTI89 / UPEC) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|B1LFR7|RS15_ECOSM 30S ribosomal protein S15 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|B6I1P0|RS15_ECOSE 30S ribosomal protein S15 OS=Escherichia coli (strain SE11) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|B7NDF1|RS15_ECOLU 30S ribosomal protein S15 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|P0ADZ4|RS15_ECOLI 30S ribosomal protein S15 OS=Escherichia coli (strain K12) GN=rpsO PE=1 SV=2 299 373 1.0E-10
sp|B1IQV6|RS15_ECOLC 30S ribosomal protein S15 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|P0ADZ5|RS15_ECOL6 30S ribosomal protein S15 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpsO PE=3 SV=2 299 373 1.0E-10
sp|Q0TCU4|RS15_ECOL5 30S ribosomal protein S15 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|A1AG70|RS15_ECOK1 30S ribosomal protein S15 OS=Escherichia coli O1:K1 / APEC GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|A8A4Y1|RS15_ECOHS 30S ribosomal protein S15 OS=Escherichia coli O9:H4 (strain HS) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|B1XGX7|RS15_ECODH 30S ribosomal protein S15 OS=Escherichia coli (strain K12 / DH10B) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|C4ZSQ6|RS15_ECOBW 30S ribosomal protein S15 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|B7M073|RS15_ECO8A 30S ribosomal protein S15 OS=Escherichia coli O8 (strain IAI1) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|B7N0V0|RS15_ECO81 30S ribosomal protein S15 OS=Escherichia coli O81 (strain ED1a) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|B7NKN4|RS15_ECO7I 30S ribosomal protein S15 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|B7LGI7|RS15_ECO55 30S ribosomal protein S15 OS=Escherichia coli (strain 55989 / EAEC) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|B7MB86|RS15_ECO45 30S ribosomal protein S15 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|B7UJ60|RS15_ECO27 30S ribosomal protein S15 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|A7ZS62|RS15_ECO24 30S ribosomal protein S15 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|Q2NBZ3|RS15_ERYLH 30S ribosomal protein S15 OS=Erythrobacter litoralis (strain HTCC2594) GN=rpsO PE=3 SV=1 291 373 1.0E-10
sp|B8IGX2|RS15_METNO 30S ribosomal protein S15 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rpsO PE=3 SV=1 288 373 1.0E-10
sp|Q2SZP0|RS15_BURTA 30S ribosomal protein S15 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rpsO PE=3 SV=2 298 373 1.0E-10
sp|Q63VN8|RS15_BURPS 30S ribosomal protein S15 OS=Burkholderia pseudomallei (strain K96243) GN=rpsO PE=3 SV=1 298 373 1.0E-10
sp|A3N7L2|RS15_BURP6 30S ribosomal protein S15 OS=Burkholderia pseudomallei (strain 668) GN=rpsO PE=3 SV=1 298 373 1.0E-10
sp|Q3JUB4|RS15_BURP1 30S ribosomal protein S15 OS=Burkholderia pseudomallei (strain 1710b) GN=rpsO PE=3 SV=2 298 373 1.0E-10
sp|A3NTA0|RS15_BURP0 30S ribosomal protein S15 OS=Burkholderia pseudomallei (strain 1106a) GN=rpsO PE=3 SV=1 298 373 1.0E-10
sp|A1V2L1|RS15_BURMS 30S ribosomal protein S15 OS=Burkholderia mallei (strain SAVP1) GN=rpsO PE=3 SV=1 298 373 1.0E-10
sp|Q62IN0|RS15_BURMA 30S ribosomal protein S15 OS=Burkholderia mallei (strain ATCC 23344) GN=rpsO PE=3 SV=1 298 373 1.0E-10
sp|A2S464|RS15_BURM9 30S ribosomal protein S15 OS=Burkholderia mallei (strain NCTC 10229) GN=rpsO PE=3 SV=1 298 373 1.0E-10
sp|A3MI96|RS15_BURM7 30S ribosomal protein S15 OS=Burkholderia mallei (strain NCTC 10247) GN=rpsO PE=3 SV=1 298 373 1.0E-10
sp|A4WEY0|RS15_ENT38 30S ribosomal protein S15 OS=Enterobacter sp. (strain 638) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|A8AQ54|RS15_CITK8 30S ribosomal protein S15 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rpsO PE=3 SV=1 299 373 1.0E-10
sp|B2JDN3|RS15_BURP8 30S ribosomal protein S15 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rpsO PE=3 SV=1 298 373 1.0E-10
sp|B5YS55|RS15_ECO5E 30S ribosomal protein S15 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rpsO PE=3 SV=1 299 373 2.0E-10
sp|Q8X9M2|RS15_ECO57 30S ribosomal protein S15 OS=Escherichia coli O157:H7 GN=rpsO PE=3 SV=1 299 373 2.0E-10
sp|Q8XXP4|RS15_RALSO 30S ribosomal protein S15 OS=Ralstonia solanacearum (strain GMI1000) GN=rpsO PE=3 SV=1 299 373 2.0E-10
sp|B1Y822|RS15_LEPCP 30S ribosomal protein S15 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rpsO PE=3 SV=1 299 373 2.0E-10
sp|P21771|RT28_YEAST 37S ribosomal protein S28, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS28 PE=1 SV=1 239 384 3.0E-10
sp|A4JGD5|RS15_BURVG 30S ribosomal protein S15 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpsO PE=3 SV=1 298 373 3.0E-10
sp|A9AJN9|RS15_BURM1 30S ribosomal protein S15 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rpsO PE=3 SV=1 298 373 3.0E-10
sp|Q39EE0|RS15_BURL3 30S ribosomal protein S15 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpsO PE=3 SV=1 298 373 3.0E-10
sp|Q0BDC5|RS15_BURCM 30S ribosomal protein S15 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpsO PE=3 SV=1 298 373 3.0E-10
sp|B4E5M7|RS15_BURCJ 30S ribosomal protein S15 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpsO PE=3 SV=1 298 373 3.0E-10
sp|A0K928|RS15_BURCH 30S ribosomal protein S15 OS=Burkholderia cenocepacia (strain HI2424) GN=rpsO PE=3 SV=1 298 373 3.0E-10
sp|B1JVP6|RS15_BURCC 30S ribosomal protein S15 OS=Burkholderia cenocepacia (strain MC0-3) GN=rpsO PE=3 SV=1 298 373 3.0E-10
sp|Q1BV08|RS15_BURCA 30S ribosomal protein S15 OS=Burkholderia cenocepacia (strain AU 1054) GN=rpsO PE=3 SV=1 298 373 3.0E-10
sp|B1YTR2|RS15_BURA4 30S ribosomal protein S15 OS=Burkholderia ambifaria (strain MC40-6) GN=rpsO PE=3 SV=1 298 373 3.0E-10
sp|B1JLX7|RS15_YERPY 30S ribosomal protein S15 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rpsO PE=3 SV=1 299 373 3.0E-10
sp|Q66F57|RS15_YERPS 30S ribosomal protein S15 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpsO PE=3 SV=1 299 373 3.0E-10
sp|A4TRI0|RS15_YERPP 30S ribosomal protein S15 OS=Yersinia pestis (strain Pestoides F) GN=rpsO PE=3 SV=1 299 373 3.0E-10
sp|Q1CEL6|RS15_YERPN 30S ribosomal protein S15 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpsO PE=3 SV=1 299 373 3.0E-10
sp|A9R5A6|RS15_YERPG 30S ribosomal protein S15 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rpsO PE=3 SV=1 299 373 3.0E-10
sp|Q8ZBC5|RS15_YERPE 30S ribosomal protein S15 OS=Yersinia pestis GN=rpsO PE=3 SV=1 299 373 3.0E-10
sp|B2K2Q8|RS15_YERPB 30S ribosomal protein S15 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rpsO PE=3 SV=1 299 373 3.0E-10
sp|Q1CC10|RS15_YERPA 30S ribosomal protein S15 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpsO PE=3 SV=1 299 373 3.0E-10
sp|A7FMR9|RS15_YERP3 30S ribosomal protein S15 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpsO PE=3 SV=1 299 373 3.0E-10
sp|A1WLP9|RS15_VEREI 30S ribosomal protein S15 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rpsO PE=3 SV=1 299 373 3.0E-10
sp|C5CT25|RS15_VARPS 30S ribosomal protein S15 OS=Variovorax paradoxus (strain S110) GN=rpsO PE=3 SV=1 299 373 3.0E-10
sp|A1TLL1|RS15_ACIAC 30S ribosomal protein S15 OS=Acidovorax citrulli (strain AAC00-1) GN=rpsO PE=3 SV=1 299 373 3.0E-10
sp|A9BNB9|RS15_DELAS 30S ribosomal protein S15 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rpsO PE=3 SV=1 299 373 4.0E-10
sp|Q87EV1|RS15_XYLFT 30S ribosomal protein S15 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rpsO PE=3 SV=1 295 373 4.0E-10
sp|B2I729|RS15_XYLF2 30S ribosomal protein S15 OS=Xylella fastidiosa (strain M23) GN=rpsO PE=3 SV=1 295 373 4.0E-10
sp|A5VCY8|RS15_SPHWW 30S ribosomal protein S15 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rpsO PE=3 SV=1 298 373 4.0E-10
sp|A4WWP1|RS15_RHOS5 30S ribosomal protein S15 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rpsO PE=3 SV=1 294 373 4.0E-10
sp|A4G648|RS15_HERAR 30S ribosomal protein S15 OS=Herminiimonas arsenicoxydans GN=rpsO PE=3 SV=1 298 373 4.0E-10
sp|B2FN87|RS15_STRMK 30S ribosomal protein S15 OS=Stenotrophomonas maltophilia (strain K279a) GN=rpsO PE=3 SV=1 295 373 4.0E-10
sp|B4SQR7|RS15_STRM5 30S ribosomal protein S15 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rpsO PE=3 SV=1 295 373 4.0E-10
sp|A1W4L7|RS15_ACISJ 30S ribosomal protein S15 OS=Acidovorax sp. (strain JS42) GN=rpsO PE=3 SV=1 299 373 4.0E-10
sp|B9MEK9|RS15_ACIET 30S ribosomal protein S15 OS=Acidovorax ebreus (strain TPSY) GN=rpsO PE=3 SV=1 299 373 4.0E-10
sp|O13602|RT28_SCHPO Probable 37S ribosomal protein S28, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrps28 PE=3 SV=1 247 383 5.0E-10
sp|Q0A7A0|RS15_ALKEH 30S ribosomal protein S15 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpsO PE=3 SV=1 298 373 5.0E-10
sp|P66431|RS15_SALTY 30S ribosomal protein S15 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpsO PE=3 SV=2 299 373 6.0E-10
sp|P66432|RS15_SALTI 30S ribosomal protein S15 OS=Salmonella typhi GN=rpsO PE=3 SV=2 299 373 6.0E-10
sp|B4TWD4|RS15_SALSV 30S ribosomal protein S15 OS=Salmonella schwarzengrund (strain CVM19633) GN=rpsO PE=3 SV=1 299 373 6.0E-10
sp|B5BGJ2|RS15_SALPK 30S ribosomal protein S15 OS=Salmonella paratyphi A (strain AKU_12601) GN=rpsO PE=3 SV=1 299 373 6.0E-10
sp|C0PZ51|RS15_SALPC 30S ribosomal protein S15 OS=Salmonella paratyphi C (strain RKS4594) GN=rpsO PE=3 SV=1 299 373 6.0E-10
sp|A9N729|RS15_SALPB 30S ribosomal protein S15 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpsO PE=3 SV=2 299 373 6.0E-10
sp|Q5PLB3|RS15_SALPA 30S ribosomal protein S15 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpsO PE=3 SV=1 299 373 6.0E-10
sp|B4T6Z5|RS15_SALNS 30S ribosomal protein S15 OS=Salmonella newport (strain SL254) GN=rpsO PE=3 SV=1 299 373 6.0E-10
sp|B4TJ03|RS15_SALHS 30S ribosomal protein S15 OS=Salmonella heidelberg (strain SL476) GN=rpsO PE=3 SV=1 299 373 6.0E-10
sp|B5REN3|RS15_SALG2 30S ribosomal protein S15 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rpsO PE=3 SV=1 299 373 6.0E-10
sp|B5QZV5|RS15_SALEP 30S ribosomal protein S15 OS=Salmonella enteritidis PT4 (strain P125109) GN=rpsO PE=3 SV=1 299 373 6.0E-10
sp|B5FI10|RS15_SALDC 30S ribosomal protein S15 OS=Salmonella dublin (strain CT_02021853) GN=rpsO PE=3 SV=1 299 373 6.0E-10
sp|Q57JI2|RS15_SALCH 30S ribosomal protein S15 OS=Salmonella choleraesuis (strain SC-B67) GN=rpsO PE=3 SV=1 299 373 6.0E-10
sp|B5F6T5|RS15_SALA4 30S ribosomal protein S15 OS=Salmonella agona (strain SL483) GN=rpsO PE=3 SV=1 299 373 6.0E-10
sp|A6TEI4|RS15_KLEP7 30S ribosomal protein S15 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpsO PE=3 SV=1 299 373 6.0E-10
sp|A6UF33|RS15_SINMW 30S ribosomal protein S15 OS=Sinorhizobium medicae (strain WSM419) GN=rpsO PE=3 SV=1 303 373 6.0E-10
sp|Q142H8|RS15_BURXL 30S ribosomal protein S15 OS=Burkholderia xenovorans (strain LB400) GN=rpsO PE=3 SV=1 298 373 6.0E-10
sp|Q0HXR2|RS15_SHESR 30S ribosomal protein S15 OS=Shewanella sp. (strain MR-7) GN=rpsO PE=3 SV=1 299 373 6.0E-10
sp|Q0HLF8|RS15_SHESM 30S ribosomal protein S15 OS=Shewanella sp. (strain MR-4) GN=rpsO PE=3 SV=1 299 373 6.0E-10
sp|A0KTZ9|RS15_SHESA 30S ribosomal protein S15 OS=Shewanella sp. (strain ANA-3) GN=rpsO PE=3 SV=1 299 373 6.0E-10
sp|Q4FVL1|RS15_PSYA2 30S ribosomal protein S15 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rpsO PE=3 SV=1 299 373 6.0E-10
sp|Q6D9A2|RS15_PECAS 30S ribosomal protein S15 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpsO PE=3 SV=1 299 373 6.0E-10
sp|Q3IYT8|RS15_RHOS4 30S ribosomal protein S15 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpsO PE=3 SV=1 294 373 7.0E-10
sp|A3PNF9|RS15_RHOS1 30S ribosomal protein S15 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpsO PE=3 SV=1 294 373 7.0E-10
sp|B9JYK9|RS15_AGRVS 30S ribosomal protein S15 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpsO PE=3 SV=1 303 373 7.0E-10
sp|Q92SW1|RS15_RHIME 30S ribosomal protein S15 OS=Rhizobium meliloti (strain 1021) GN=rpsO PE=3 SV=1 303 373 7.0E-10
sp|A9W8P9|RS15_METEP 30S ribosomal protein S15 OS=Methylobacterium extorquens (strain PA1) GN=rpsO PE=3 SV=1 288 373 8.0E-10
sp|B7KN56|RS15_METC4 30S ribosomal protein S15 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpsO PE=3 SV=1 288 373 8.0E-10
sp|B1ZGS8|RS15_METPB 30S ribosomal protein S15 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpsO PE=3 SV=1 288 373 8.0E-10
sp|B3R3W1|RS15_CUPTR 30S ribosomal protein S15 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rpsO PE=3 SV=1 299 373 9.0E-10
sp|Q0KCT5|RS15_CUPNH 30S ribosomal protein S15 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rpsO PE=3 SV=1 299 373 9.0E-10
sp|B5XSX7|RS15_KLEP3 30S ribosomal protein S15 OS=Klebsiella pneumoniae (strain 342) GN=rpsO PE=3 SV=1 299 373 9.0E-10
sp|A6SY01|RS15_JANMA 30S ribosomal protein S15 OS=Janthinobacterium sp. (strain Marseille) GN=rpsO PE=3 SV=1 298 373 9.0E-10
sp|Q0AK63|RS15_MARMM 30S ribosomal protein S15 OS=Maricaulis maris (strain MCS10) GN=rpsO PE=3 SV=1 288 373 9.0E-10
sp|B0U1R1|RS15_XYLFM 30S ribosomal protein S15 OS=Xylella fastidiosa (strain M12) GN=rpsO PE=3 SV=1 295 373 1.0E-09
sp|Q9PGR0|RS15_XYLFA 30S ribosomal protein S15 OS=Xylella fastidiosa (strain 9a5c) GN=rpsO PE=3 SV=1 295 373 1.0E-09
sp|Q1GVQ9|RS15_SPHAL 30S ribosomal protein S15 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rpsO PE=3 SV=1 298 373 1.0E-09
sp|Q1QEP0|RS15_PSYCK 30S ribosomal protein S15 OS=Psychrobacter cryohalolentis (strain K5) GN=rpsO PE=3 SV=1 299 373 1.0E-09
sp|Q127W7|RS15_POLSJ 30S ribosomal protein S15 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpsO PE=3 SV=1 299 373 1.0E-09
sp|A1WXU8|RS15_HALHL 30S ribosomal protein S15 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rpsO PE=3 SV=1 295 373 1.0E-09
sp|Q98BI4|RS15_RHILO 30S ribosomal protein S15 OS=Rhizobium loti (strain MAFF303099) GN=rpsO PE=3 SV=1 303 373 1.0E-09
sp|Q2G5F4|RS15_NOVAD 30S ribosomal protein S15 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rpsO PE=3 SV=1 295 373 2.0E-09
sp|A1U5Z7|RS15_MARHV 30S ribosomal protein S15 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpsO PE=3 SV=1 300 373 2.0E-09
sp|Q473U8|RS15_CUPPJ 30S ribosomal protein S15 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rpsO PE=3 SV=1 299 373 2.0E-09
sp|Q8EHL3|RS15_SHEON 30S ribosomal protein S15 OS=Shewanella oneidensis (strain MR-1) GN=rpsO PE=3 SV=1 299 373 2.0E-09
sp|A7IC04|RS15_XANP2 30S ribosomal protein S15 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpsO PE=3 SV=1 303 373 2.0E-09
sp|C5BFC0|RS15_EDWI9 30S ribosomal protein S15 OS=Edwardsiella ictaluri (strain 93-146) GN=rpsO PE=3 SV=1 299 373 2.0E-09
sp|Q88DV9|RS15_PSEPK 30S ribosomal protein S15 OS=Pseudomonas putida (strain KT2440) GN=rpsO PE=3 SV=2 303 373 2.0E-09
sp|A5W984|RS15_PSEP1 30S ribosomal protein S15 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpsO PE=3 SV=1 303 373 2.0E-09
sp|B2U7R7|RS15_RALPJ 30S ribosomal protein S15 OS=Ralstonia pickettii (strain 12J) GN=rpsO PE=3 SV=1 299 373 2.0E-09
sp|O34274|RS15_YEREN 30S ribosomal protein S15 OS=Yersinia enterocolitica GN=rpsO PE=3 SV=3 299 373 3.0E-09
sp|A1JIX2|RS15_YERE8 30S ribosomal protein S15 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpsO PE=3 SV=1 299 373 3.0E-09
sp|B4F2C2|RS15_PROMH 30S ribosomal protein S15 OS=Proteus mirabilis (strain HI4320) GN=rpsO PE=3 SV=1 299 373 3.0E-09
sp|Q1LPW9|RS15_CUPMC 30S ribosomal protein S15 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rpsO PE=3 SV=1 299 373 3.0E-09
sp|Q2SML0|RS15_HAHCH 30S ribosomal protein S15 OS=Hahella chejuensis (strain KCTC 2396) GN=rpsO PE=3 SV=1 303 373 4.0E-09
sp|A6VQB6|RS15_ACTSZ 30S ribosomal protein S15 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpsO PE=3 SV=1 299 373 4.0E-09
sp|Q21YD2|RS15_RHOFT 30S ribosomal protein S15 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rpsO PE=3 SV=1 303 373 4.0E-09
sp|C5BPV6|RS15_TERTT 30S ribosomal protein S15 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rpsO PE=3 SV=1 302 373 4.0E-09
sp|B4RC49|RS15_PHEZH 30S ribosomal protein S15 OS=Phenylobacterium zucineum (strain HLK1) GN=rpsO PE=3 SV=1 298 373 4.0E-09
sp|Q6FF13|RS15_ACIAD 30S ribosomal protein S15 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rpsO PE=3 SV=1 298 373 4.0E-09
sp|Q7VKX3|RS15_HAEDU 30S ribosomal protein S15 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpsO PE=3 SV=1 299 373 4.0E-09
sp|Q11BC4|RS15_CHESB 30S ribosomal protein S15 OS=Chelativorans sp. (strain BNC1) GN=rpsO PE=3 SV=1 300 373 5.0E-09
sp|Q7MI12|RS15_VIBVY 30S ribosomal protein S15 OS=Vibrio vulnificus (strain YJ016) GN=rpsO PE=3 SV=1 298 373 5.0E-09
sp|Q8DBV5|RS15_VIBVU 30S ribosomal protein S15 OS=Vibrio vulnificus (strain CMCP6) GN=rpsO PE=3 SV=1 298 373 5.0E-09
sp|B8E2S4|RS15_DICTD 30S ribosomal protein S15 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rpsO PE=3 SV=1 303 373 5.0E-09
sp|B0USL5|RS15_HISS2 30S ribosomal protein S15 OS=Histophilus somni (strain 2336) GN=rpsO PE=3 SV=1 299 373 5.0E-09
sp|Q0I275|RS15_HAES1 30S ribosomal protein S15 OS=Haemophilus somnus (strain 129Pt) GN=rpsO PE=3 SV=1 299 373 5.0E-09
sp|Q7NY11|RS15_CHRVO 30S ribosomal protein S15 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rpsO PE=3 SV=1 299 373 5.0E-09
sp|C0QTM4|RS15_PERMH 30S ribosomal protein S15 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=rpsO PE=3 SV=1 303 377 6.0E-09
sp|Q2NW20|RS15_SODGM 30S ribosomal protein S15 OS=Sodalis glossinidius (strain morsitans) GN=rpsO PE=3 SV=1 302 373 6.0E-09
sp|Q1QSZ3|RS15_CHRSD 30S ribosomal protein S15 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rpsO PE=3 SV=1 299 373 7.0E-09
sp|A8IGA5|RS15_AZOC5 30S ribosomal protein S15 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpsO PE=3 SV=1 303 373 7.0E-09
sp|B0T174|RS15_CAUSK 30S ribosomal protein S15 OS=Caulobacter sp. (strain K31) GN=rpsO PE=3 SV=1 288 373 7.0E-09
sp|A4SXQ8|RS15_POLSQ 30S ribosomal protein S15 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rpsO PE=3 SV=1 299 373 7.0E-09
sp|Q9AC31|RS15_CAUCR 30S ribosomal protein S15 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rpsO PE=3 SV=1 288 373 7.0E-09
sp|B8GWZ1|RS15_CAUCN 30S ribosomal protein S15 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rpsO PE=3 SV=1 288 373 7.0E-09
sp|A1VG87|RS15_DESVV 30S ribosomal protein S15 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rpsO PE=3 SV=1 303 373 7.0E-09
sp|Q72ER5|RS15_DESVH 30S ribosomal protein S15 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rpsO PE=3 SV=1 303 373 7.0E-09
sp|Q0BWM8|RS15_HYPNA 30S ribosomal protein S15 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpsO PE=3 SV=1 303 373 7.0E-09
sp|Q83D88|RS15_COXBU 30S ribosomal protein S15 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpsO PE=3 SV=1 300 373 7.0E-09
sp|A9ND63|RS15_COXBR 30S ribosomal protein S15 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rpsO PE=3 SV=1 300 373 7.0E-09
sp|A9KFK5|RS15_COXBN 30S ribosomal protein S15 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rpsO PE=3 SV=1 300 373 7.0E-09
sp|B6J6S6|RS15_COXB1 30S ribosomal protein S15 OS=Coxiella burnetii (strain CbuK_Q154) GN=rpsO PE=3 SV=1 300 373 7.0E-09
sp|Q1GXD3|RS15_METFK 30S ribosomal protein S15 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rpsO PE=3 SV=1 303 373 9.0E-09
sp|B2VGN5|RS15_ERWT9 30S ribosomal protein S15 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rpsO PE=3 SV=1 299 373 9.0E-09
sp|Q0VSR8|RS15_ALCBS 30S ribosomal protein S15 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rpsO PE=3 SV=1 303 373 9.0E-09
sp|A3QGU2|RS15_SHELP 30S ribosomal protein S15 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rpsO PE=3 SV=1 299 373 1.0E-08
sp|C4L8X1|RS15_TOLAT 30S ribosomal protein S15 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rpsO PE=3 SV=1 298 373 1.0E-08
sp|B5YEA9|RS15_DICT6 30S ribosomal protein S15 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=rpsO PE=3 SV=1 303 373 1.0E-08
sp|C3MC70|RS15_RHISN 30S ribosomal protein S15 OS=Rhizobium sp. (strain NGR234) GN=rpsO PE=3 SV=1 303 373 1.0E-08
sp|Q1IF40|RS15_PSEE4 30S ribosomal protein S15 OS=Pseudomonas entomophila (strain L48) GN=rpsO PE=3 SV=1 303 373 1.0E-08
sp|Q3ZXV7|RS15_DEHMC 30S ribosomal protein S15 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rpsO PE=3 SV=1 302 373 1.0E-08
sp|A5FQT1|RS15_DEHMB 30S ribosomal protein S15 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rpsO PE=3 SV=1 302 373 1.0E-08
sp|A5WBT1|RS15_PSYWF 30S ribosomal protein S15 OS=Psychrobacter sp. (strain PRwf-1) GN=rpsO PE=3 SV=1 303 373 1.0E-08
sp|Q21H64|RS15_SACD2 30S ribosomal protein S15 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rpsO PE=3 SV=1 284 373 1.0E-08
sp|B3PI99|RS15_CELJU 30S ribosomal protein S15 OS=Cellvibrio japonicus (strain Ueda107) GN=rpsO PE=3 SV=1 303 373 1.0E-08
sp|Q2Y5X8|RS15_NITMU 30S ribosomal protein S15 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rpsO PE=3 SV=1 299 373 1.0E-08
sp|Q3KI81|RS15_PSEPF 30S ribosomal protein S15 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rpsO PE=3 SV=1 303 373 2.0E-08
sp|A1VM55|RS15_POLNA 30S ribosomal protein S15 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rpsO PE=3 SV=1 299 373 2.0E-08
sp|Q1GKK2|RS15_RUEST 30S ribosomal protein S15 OS=Ruegeria sp. (strain TM1040) GN=rpsO PE=3 SV=1 294 373 2.0E-08
sp|B1ZS99|RS15_OPITP 30S ribosomal protein S15 OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=rpsO PE=3 SV=1 303 373 2.0E-08
sp|B8DN08|RS15_DESVM 30S ribosomal protein S15 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rpsO PE=3 SV=1 303 373 2.0E-08
sp|A8FYR7|RS15_SHESH 30S ribosomal protein S15 OS=Shewanella sediminis (strain HAW-EB3) GN=rpsO PE=3 SV=1 299 373 2.0E-08
sp|B8CW77|RS15_HALOH 30S ribosomal protein S15 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=rpsO PE=3 SV=1 303 373 2.0E-08
sp|Q5LLT1|RS15_RUEPO 30S ribosomal protein S15 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpsO PE=3 SV=1 303 373 2.0E-08
sp|B7IFB5|RS15_THEAB 30S ribosomal protein S15 OS=Thermosipho africanus (strain TCF52B) GN=rpsO PE=3 SV=1 303 373 2.0E-08
sp|Q04ZJ8|RS15_LEPBL 30S ribosomal protein S15 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=rpsO PE=3 SV=1 298 373 2.0E-08
sp|Q04U28|RS15_LEPBJ 30S ribosomal protein S15 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=rpsO PE=3 SV=1 298 373 2.0E-08
sp|Q4ZNR5|RS15_PSEU2 30S ribosomal protein S15 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rpsO PE=3 SV=1 303 373 2.0E-08
sp|Q87WQ7|RS15_PSESM 30S ribosomal protein S15 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rpsO PE=3 SV=1 303 373 2.0E-08
sp|Q48E80|RS15_PSE14 30S ribosomal protein S15 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rpsO PE=3 SV=1 303 373 2.0E-08
sp|B1J2B2|RS15_PSEPW 30S ribosomal protein S15 OS=Pseudomonas putida (strain W619) GN=rpsO PE=3 SV=1 303 373 2.0E-08
sp|B0KHX5|RS15_PSEPG 30S ribosomal protein S15 OS=Pseudomonas putida (strain GB-1) GN=rpsO PE=3 SV=1 303 373 2.0E-08
sp|Q65UQ4|RS15_MANSM 30S ribosomal protein S15 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpsO PE=3 SV=1 299 373 2.0E-08
sp|B8F5Z2|RS15_HAEPS 30S ribosomal protein S15 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rpsO PE=3 SV=1 299 373 2.0E-08
sp|B0BPU4|RS15_ACTPJ 30S ribosomal protein S15 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rpsO PE=3 SV=1 299 373 2.0E-08
sp|B3H1N7|RS15_ACTP7 30S ribosomal protein S15 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rpsO PE=3 SV=1 299 373 2.0E-08
sp|A3N113|RS15_ACTP2 30S ribosomal protein S15 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpsO PE=3 SV=1 299 373 2.0E-08
sp|Q3YSC5|RS15_EHRCJ 30S ribosomal protein S15 OS=Ehrlichia canis (strain Jake) GN=rpsO PE=3 SV=1 303 373 2.0E-08
sp|Q9HV58|RS15_PSEAE 30S ribosomal protein S15 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rpsO PE=3 SV=1 303 373 2.0E-08
sp|Q02FT1|RS15_PSEAB 30S ribosomal protein S15 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rpsO PE=3 SV=1 303 373 2.0E-08
sp|B7V1F3|RS15_PSEA8 30S ribosomal protein S15 OS=Pseudomonas aeruginosa (strain LESB58) GN=rpsO PE=3 SV=1 303 373 2.0E-08
sp|A6VCJ8|RS15_PSEA7 30S ribosomal protein S15 OS=Pseudomonas aeruginosa (strain PA7) GN=rpsO PE=3 SV=1 303 373 2.0E-08
sp|Q2VZQ5|RS15_MAGSA 30S ribosomal protein S15 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rpsO PE=3 SV=1 294 373 2.0E-08
sp|Q82XS9|RS15_NITEU 30S ribosomal protein S15 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rpsO PE=3 SV=1 299 373 2.0E-08
sp|P44389|RS15_HAEIN 30S ribosomal protein S15 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpsO1 PE=3 SV=2 299 373 2.0E-08
sp|A5UEY4|RS15_HAEIG 30S ribosomal protein S15 OS=Haemophilus influenzae (strain PittGG) GN=rpsO PE=3 SV=1 299 373 2.0E-08
sp|Q4KIF3|RS15_PSEF5 30S ribosomal protein S15 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rpsO PE=3 SV=1 303 373 3.0E-08
sp|Q0AE54|RS15_NITEC 30S ribosomal protein S15 OS=Nitrosomonas eutropha (strain C91) GN=rpsO PE=3 SV=1 299 373 3.0E-08
sp|A4VPN7|RS15_PSEU5 30S ribosomal protein S15 OS=Pseudomonas stutzeri (strain A1501) GN=rpsO PE=3 SV=1 303 373 3.0E-08
sp|A4XYD7|RS15_PSEMY 30S ribosomal protein S15 OS=Pseudomonas mendocina (strain ymp) GN=rpsO PE=3 SV=1 303 373 3.0E-08
sp|Q18BI0|RS15_PEPD6 30S ribosomal protein S15 OS=Peptoclostridium difficile (strain 630) GN=rpsO PE=3 SV=1 303 373 3.0E-08
sp|Q3SKX4|RS15_THIDA 30S ribosomal protein S15 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rpsO PE=3 SV=1 299 373 3.0E-08
sp|C4K3E7|RS15_HAMD5 30S ribosomal protein S15 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rpsO PE=3 SV=1 303 373 3.0E-08
sp|A4XL65|RS15_CALS8 30S ribosomal protein S15 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpsO PE=3 SV=1 303 373 3.0E-08
sp|A1UU53|RS15_BARBK 30S ribosomal protein S15 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rpsO PE=3 SV=1 295 373 3.0E-08
sp|A1RGX8|RS15_SHESW 30S ribosomal protein S15 OS=Shewanella sp. (strain W3-18-1) GN=rpsO PE=3 SV=1 299 373 3.0E-08
sp|A4Y9B7|RS15_SHEPC 30S ribosomal protein S15 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rpsO PE=3 SV=1 299 373 3.0E-08
sp|Q7VZU1|RS15_BORPE 30S ribosomal protein S15 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rpsO PE=3 SV=1 299 373 3.0E-08
sp|A9IGJ8|RS15_BORPD 30S ribosomal protein S15 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rpsO PE=3 SV=1 299 373 3.0E-08
sp|Q7W569|RS15_BORPA 30S ribosomal protein S15 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rpsO PE=3 SV=1 299 373 3.0E-08
sp|Q7WCP9|RS15_BORBR 30S ribosomal protein S15 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rpsO PE=3 SV=1 299 373 3.0E-08
sp|A1S465|RS15_SHEAM 30S ribosomal protein S15 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpsO PE=3 SV=1 299 373 3.0E-08
sp|Q6MMS3|RS15_BDEBA 30S ribosomal protein S15 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rpsO PE=3 SV=1 303 358 3.0E-08
sp|B9MR53|RS15_CALBD 30S ribosomal protein S15 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rpsO PE=3 SV=1 303 373 3.0E-08
sp|C1DFK6|RS15_AZOVD 30S ribosomal protein S15 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rpsO PE=3 SV=1 303 373 3.0E-08
sp|B6IVG1|RS15_RHOCS 30S ribosomal protein S15 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rpsO PE=3 SV=1 303 373 4.0E-08
sp|Q28K15|RS15_JANSC 30S ribosomal protein S15 OS=Jannaschia sp. (strain CCS1) GN=rpsO PE=3 SV=1 294 373 4.0E-08
sp|Q2KWI4|RS15_BORA1 30S ribosomal protein S15 OS=Bordetella avium (strain 197N) GN=rpsO PE=3 SV=1 299 373 4.0E-08
sp|Q3Z7V7|RS15_DEHM1 30S ribosomal protein S15 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rpsO PE=3 SV=1 303 373 4.0E-08
sp|Q4FNM7|RS15_PELUB 30S ribosomal protein S15 OS=Pelagibacter ubique (strain HTCC1062) GN=rpsO PE=3 SV=1 290 356 4.0E-08
sp|B1KRQ7|RS15_SHEWM 30S ribosomal protein S15 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rpsO PE=3 SV=1 303 373 4.0E-08
sp|Q5FQM0|RS15_GLUOX 30S ribosomal protein S15 OS=Gluconobacter oxydans (strain 621H) GN=rpsO PE=3 SV=1 302 373 4.0E-08
sp|Q5NZR8|RS15_AROAE 30S ribosomal protein S15 OS=Aromatoleum aromaticum (strain EbN1) GN=rpsO PE=3 SV=1 299 373 4.0E-08
sp|P41120|RS15_PHOLU 30S ribosomal protein S15 OS=Photorhabdus luminescens GN=rpsO PE=3 SV=3 299 373 4.0E-08
sp|A8H737|RS15_SHEPA 30S ribosomal protein S15 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rpsO PE=3 SV=1 299 373 5.0E-08
sp|B0TQ99|RS15_SHEHH 30S ribosomal protein S15 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rpsO PE=3 SV=1 299 373 5.0E-08
sp|A5CC63|RS15_ORITB 30S ribosomal protein S15 OS=Orientia tsutsugamushi (strain Boryong) GN=rpsO PE=3 SV=1 303 373 5.0E-08
sp|B8J1Y0|RS15_DESDA 30S ribosomal protein S15 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=rpsO PE=3 SV=1 303 373 5.0E-08
sp|A8LKE4|RS15_DINSH 30S ribosomal protein S15 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpsO PE=3 SV=1 294 373 5.0E-08
sp|B1I392|RS15_DESAP 30S ribosomal protein S15 OS=Desulforudis audaxviator (strain MP104C) GN=rpsO PE=3 SV=1 303 373 5.0E-08
sp|Q5QTZ1|RS15_IDILO 30S ribosomal protein S15 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rpsO PE=3 SV=1 300 373 5.0E-08
sp|Q0BPK2|RS15_GRABC 30S ribosomal protein S15 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpsO PE=3 SV=1 288 373 5.0E-08
sp|A4SJR8|RS15_AERS4 30S ribosomal protein S15 OS=Aeromonas salmonicida (strain A449) GN=rpsO PE=3 SV=1 299 373 5.0E-08
sp|B2V901|RS15_SULSY 30S ribosomal protein S15 OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rpsO PE=3 SV=1 303 380 5.0E-08
sp|C3K256|RS15_PSEFS 30S ribosomal protein S15 OS=Pseudomonas fluorescens (strain SBW25) GN=rpsO PE=3 SV=1 303 373 5.0E-08
sp|B8CKH6|RS15_SHEPW 30S ribosomal protein S15 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rpsO PE=3 SV=1 299 373 5.0E-08
sp|A0KNE0|RS15_AERHH 30S ribosomal protein S15 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpsO PE=3 SV=1 299 373 6.0E-08
sp|A1B5Q0|RS15_PARDP 30S ribosomal protein S15 OS=Paracoccus denitrificans (strain Pd 1222) GN=rpsO PE=3 SV=1 295 373 6.0E-08
sp|A6LJ39|RS15_THEM4 30S ribosomal protein S15 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rpsO PE=3 SV=1 303 373 6.0E-08
sp|C4LJ75|RS15_CORK4 30S ribosomal protein S15 OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=rpsO PE=3 SV=1 270 373 7.0E-08
sp|B3CTX2|RS15_ORITI 30S ribosomal protein S15 OS=Orientia tsutsugamushi (strain Ikeda) GN=rpsO PE=3 SV=1 303 373 7.0E-08
sp|Q9CNX1|RS15_PASMU 30S ribosomal protein S15 OS=Pasteurella multocida (strain Pm70) GN=rpsO PE=3 SV=1 299 373 7.0E-08
sp|Q7MYY9|RS15_PHOLL 30S ribosomal protein S15 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpsO PE=3 SV=1 299 373 8.0E-08
sp|Q8F7J9|RS15_LEPIN 30S ribosomal protein S15 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rpsO PE=3 SV=2 298 373 8.0E-08
sp|Q72NX6|RS15_LEPIC 30S ribosomal protein S15 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rpsO PE=3 SV=1 298 373 8.0E-08
sp|B9DPD9|RS15_STACT 30S ribosomal protein S15 OS=Staphylococcus carnosus (strain TM300) GN=rpsO PE=3 SV=1 302 373 8.0E-08
sp|B8HG66|RS15_ARTCA 30S ribosomal protein S15 OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=rpsO PE=3 SV=1 300 373 9.0E-08
sp|B7GG70|RS15_ANOFW 30S ribosomal protein S15 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rpsO PE=3 SV=1 303 373 9.0E-08
sp|A0LHM3|RS15_SYNFM 30S ribosomal protein S15 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rpsO PE=3 SV=1 303 373 9.0E-08
sp|Q2GGA3|RS15_EHRCR 30S ribosomal protein S15 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rpsO PE=3 SV=1 303 373 1.0E-07
sp|A1ST52|RS15_PSYIN 30S ribosomal protein S15 OS=Psychromonas ingrahamii (strain 37) GN=rpsO PE=3 SV=1 299 373 1.0E-07
sp|Q5L0I3|RS15_GEOKA 30S ribosomal protein S15 OS=Geobacillus kaustophilus (strain HTA426) GN=rpsO PE=3 SV=1 303 373 1.0E-07
sp|A6W814|RS15_KINRD 30S ribosomal protein S15 OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=rpsO PE=3 SV=2 303 373 1.0E-07
sp|A1AVW6|RS15_RUTMC 30S ribosomal protein S15 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rpsO PE=3 SV=1 303 373 1.0E-07
sp|A4J5W7|RS15_DESRM 30S ribosomal protein S15 OS=Desulfotomaculum reducens (strain MI-1) GN=rpsO PE=3 SV=1 303 373 1.0E-07
sp|Q4JV58|RS15_CORJK 30S ribosomal protein S15 OS=Corynebacterium jeikeium (strain K411) GN=rpsO PE=3 SV=1 302 373 1.0E-07
sp|Q15V69|RS15_PSEA6 30S ribosomal protein S15 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rpsO PE=3 SV=1 303 373 1.0E-07
sp|Q5HBH7|RS15_EHRRW 30S ribosomal protein S15 OS=Ehrlichia ruminantium (strain Welgevonden) GN=rpsO PE=3 SV=1 303 373 1.0E-07
sp|Q5FHK6|RS15_EHRRG 30S ribosomal protein S15 OS=Ehrlichia ruminantium (strain Gardel) GN=rpsO PE=3 SV=1 303 373 1.0E-07
sp|A0RPX5|RS15_CAMFF 30S ribosomal protein S15 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=rpsO PE=3 SV=1 298 373 1.0E-07
sp|Q4QKJ8|RS15_HAEI8 30S ribosomal protein S15 OS=Haemophilus influenzae (strain 86-028NP) GN=rpsO PE=3 SV=1 299 373 1.0E-07
sp|B5Y8I3|RS15_COPPD 30S ribosomal protein S15 OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=rpsO PE=3 SV=1 303 373 1.0E-07
sp|A9NGE3|RS15_ACHLI 30S ribosomal protein S15 OS=Acholeplasma laidlawii (strain PG-8A) GN=rpsO PE=3 SV=1 295 373 1.0E-07
sp|A7HNS0|RS15_FERNB 30S ribosomal protein S15 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rpsO PE=3 SV=1 303 373 1.0E-07
sp|C0QHM5|RS15_DESAH 30S ribosomal protein S15 OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=rpsO PE=3 SV=1 303 373 1.0E-07
sp|A7ZEC8|RS15_CAMC1 30S ribosomal protein S15 OS=Campylobacter concisus (strain 13826) GN=rpsO PE=3 SV=1 303 373 1.0E-07
sp|B1YI58|RS15_EXIS2 30S ribosomal protein S15 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpsO PE=3 SV=1 303 373 1.0E-07
sp|B1XUJ4|RS15_POLNS 30S ribosomal protein S15 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=rpsO PE=3 SV=1 299 373 1.0E-07
sp|Q87M05|RS15_VIBPA 30S ribosomal protein S15 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rpsO PE=3 SV=1 303 373 1.0E-07
sp|A5EXU1|RS15_DICNV 30S ribosomal protein S15 OS=Dichelobacter nodosus (strain VCS1703A) GN=rpsO PE=3 SV=1 303 373 2.0E-07
sp|B4RXU2|RS15_ALTMD 30S ribosomal protein S15 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rpsO PE=3 SV=1 303 373 2.0E-07
sp|Q3ABA4|RS15_CARHZ 30S ribosomal protein S15 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpsO PE=3 SV=1 303 373 2.0E-07
sp|B8GP05|RS15_THISH 30S ribosomal protein S15 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rpsO PE=3 SV=1 295 373 2.0E-07
sp|A9KZW8|RS15_SHEB9 30S ribosomal protein S15 OS=Shewanella baltica (strain OS195) GN=rpsO PE=3 SV=1 303 373 2.0E-07
sp|A3D7K3|RS15_SHEB5 30S ribosomal protein S15 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rpsO PE=3 SV=1 303 373 2.0E-07
sp|B8E6N5|RS15_SHEB2 30S ribosomal protein S15 OS=Shewanella baltica (strain OS223) GN=rpsO PE=3 SV=1 303 373 2.0E-07
sp|A5UC84|RS15_HAEIE 30S ribosomal protein S15 OS=Haemophilus influenzae (strain PittEE) GN=rpsO PE=3 SV=1 299 358 2.0E-07
sp|C4L6J5|RS15_EXISA 30S ribosomal protein S15 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rpsO PE=3 SV=1 295 373 2.0E-07
sp|Q30SM6|RS15_SULDN 30S ribosomal protein S15 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=rpsO PE=3 SV=1 299 373 2.0E-07
sp|A6VU32|RS15_MARMS 30S ribosomal protein S15 OS=Marinomonas sp. (strain MWYL1) GN=rpsO PE=3 SV=1 303 373 2.0E-07
sp|C3LSQ1|RS15_VIBCM 30S ribosomal protein S15 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rpsO PE=3 SV=1 298 373 2.0E-07
sp|Q9KU77|RS15_VIBCH 30S ribosomal protein S15 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpsO PE=3 SV=1 298 373 2.0E-07
sp|A5F929|RS15_VIBC3 30S ribosomal protein S15 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpsO PE=3 SV=1 298 373 2.0E-07
sp|B1HR10|RS15_LYSSC 30S ribosomal protein S15 OS=Lysinibacillus sphaericus (strain C3-41) GN=rpsO PE=3 SV=1 303 373 2.0E-07
sp|A0LE15|RS15_MAGMM 30S ribosomal protein S15 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rpsO PE=3 SV=1 303 373 2.0E-07
sp|Q30WI6|RS15_DESAG 30S ribosomal protein S15 OS=Desulfovibrio alaskensis (strain G20) GN=rpsO PE=3 SV=1 303 373 2.0E-07
sp|B3EAF1|RS15_GEOLS 30S ribosomal protein S15 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rpsO PE=3 SV=1 303 373 2.0E-07
sp|C1D8W9|RS15_LARHH 30S ribosomal protein S15 OS=Laribacter hongkongensis (strain HLHK9) GN=rpsO PE=3 SV=1 299 373 2.0E-07
sp|A6WRG5|RS15_SHEB8 30S ribosomal protein S15 OS=Shewanella baltica (strain OS185) GN=rpsO PE=3 SV=1 303 373 2.0E-07
sp|C6C0C8|RS15_DESAD 30S ribosomal protein S15 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rpsO PE=3 SV=1 303 373 3.0E-07
sp|Q609C5|RS15_METCA 30S ribosomal protein S15 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rpsO PE=3 SV=1 282 373 3.0E-07
sp|Q8DJL5|RS15_THEEB 30S ribosomal protein S15 OS=Thermosynechococcus elongatus (strain BP-1) GN=rpsO PE=3 SV=2 301 373 3.0E-07
sp|P05766|RS15_GEOSE 30S ribosomal protein S15 OS=Geobacillus stearothermophilus GN=rpsO PE=1 SV=3 303 373 3.0E-07
sp|Q39VA2|RS15_GEOMG 30S ribosomal protein S15 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rpsO PE=3 SV=1 299 373 3.0E-07
sp|Q47D97|RS15_DECAR 30S ribosomal protein S15 OS=Dechloromonas aromatica (strain RCB) GN=rpsO PE=3 SV=1 303 373 3.0E-07
sp|B5EMD3|RS15_ACIF5 30S ribosomal protein S15 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rpsO PE=3 SV=1 303 373 3.0E-07
sp|B7J4D7|RS15_ACIF2 30S ribosomal protein S15 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rpsO PE=3 SV=1 303 373 3.0E-07
sp|A1K7B6|RS15_AZOSB 30S ribosomal protein S15 OS=Azoarcus sp. (strain BH72) GN=rpsO PE=3 SV=1 299 373 3.0E-07
sp|A1AMM5|RS15_PELPD 30S ribosomal protein S15 OS=Pelobacter propionicus (strain DSM 2379) GN=rpsO PE=3 SV=1 303 373 3.0E-07
sp|Q49X61|RS15_STAS1 30S ribosomal protein S15 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpsO PE=3 SV=1 302 373 3.0E-07
sp|B0SQH7|RS15_LEPBP 30S ribosomal protein S15 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=rpsO PE=3 SV=1 303 373 4.0E-07
sp|B0SH21|RS15_LEPBA 30S ribosomal protein S15 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=rpsO PE=3 SV=1 303 373 4.0E-07
sp|A8ZZ60|RS15_DESOH 30S ribosomal protein S15 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=rpsO PE=3 SV=1 303 373 4.0E-07
sp|B0VEA4|RS15_ACIBY 30S ribosomal protein S15 OS=Acinetobacter baumannii (strain AYE) GN=rpsO PE=3 SV=1 298 373 4.0E-07
sp|A3M1M6|RS15_ACIBT 30S ribosomal protein S15 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rpsO PE=3 SV=1 298 373 4.0E-07
sp|B0VLR8|RS15_ACIBS 30S ribosomal protein S15 OS=Acinetobacter baumannii (strain SDF) GN=rpsO PE=3 SV=1 298 373 4.0E-07
sp|B2I2P9|RS15_ACIBC 30S ribosomal protein S15 OS=Acinetobacter baumannii (strain ACICU) GN=rpsO PE=3 SV=1 298 373 4.0E-07
sp|B7I3U0|RS15_ACIB5 30S ribosomal protein S15 OS=Acinetobacter baumannii (strain AB0057) GN=rpsO PE=3 SV=1 298 373 4.0E-07
sp|B7H0Z2|RS15_ACIB3 30S ribosomal protein S15 OS=Acinetobacter baumannii (strain AB307-0294) GN=rpsO PE=3 SV=1 298 373 4.0E-07
sp|A9KNL0|RS15_CLOPH 30S ribosomal protein S15 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rpsO PE=3 SV=1 299 373 4.0E-07
sp|Q31GK0|RS15_THICR 30S ribosomal protein S15 OS=Thiomicrospira crunogena (strain XCL-2) GN=rpsO PE=3 SV=1 303 373 4.0E-07
sp|A9IMS2|RS15_BART1 30S ribosomal protein S15 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpsO PE=3 SV=1 295 373 4.0E-07
sp|A8FDD6|RS15_BACP2 30S ribosomal protein S15 OS=Bacillus pumilus (strain SAFR-032) GN=rpsO PE=3 SV=1 302 373 4.0E-07
sp|Q6AFQ4|RS15_LEIXX 30S ribosomal protein S15 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=rpsO PE=3 SV=1 303 373 4.0E-07
sp|Q7VQM1|RS15_BLOFL 30S ribosomal protein S15 OS=Blochmannia floridanus GN=rpsO PE=3 SV=1 303 373 4.0E-07
sp|B1LZQ2|RS15_METRJ 30S ribosomal protein S15 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpsO PE=3 SV=1 288 373 4.0E-07
sp|A7GXT2|RS15_CAMC5 30S ribosomal protein S15 OS=Campylobacter curvus (strain 525.92) GN=rpsO PE=3 SV=1 303 373 5.0E-07
sp|Q8CST2|RS15_STAES 30S ribosomal protein S15 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpsO PE=3 SV=1 302 373 5.0E-07
sp|Q5HPR8|RS15_STAEQ 30S ribosomal protein S15 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpsO PE=3 SV=1 302 373 5.0E-07
sp|Q5NQ31|RS15_ZYMMO 30S ribosomal protein S15 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rpsO PE=3 SV=1 288 373 5.0E-07
sp|B8FCY9|RS15_DESAA 30S ribosomal protein S15 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=rpsO PE=3 SV=1 303 373 5.0E-07
sp|Q5HUS3|RS15_CAMJR 30S ribosomal protein S15 OS=Campylobacter jejuni (strain RM1221) GN=rpsO PE=3 SV=1 303 373 5.0E-07
sp|A1VZL9|RS15_CAMJJ 30S ribosomal protein S15 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rpsO PE=3 SV=1 303 373 5.0E-07
sp|Q0PA13|RS15_CAMJE 30S ribosomal protein S15 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rpsO PE=1 SV=1 303 373 5.0E-07
sp|A8FLT4|RS15_CAMJ8 30S ribosomal protein S15 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rpsO PE=3 SV=1 303 373 5.0E-07
sp|B7KAZ5|RS15_CYAP7 30S ribosomal protein S15 OS=Cyanothece sp. (strain PCC 7424) GN=rpsO PE=3 SV=1 301 373 6.0E-07
sp|Q1LSL1|RS15_BAUCH 30S ribosomal protein S15 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rpsO PE=3 SV=2 299 373 6.0E-07
sp|Q65JH6|RS15_BACLD 30S ribosomal protein S15 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpsO PE=3 SV=1 303 373 6.0E-07
sp|Q1AW49|RS15_RUBXD 30S ribosomal protein S15 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rpsO PE=3 SV=1 303 373 6.0E-07
sp|A9B8G2|RS15_HERA2 30S ribosomal protein S15 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rpsO PE=3 SV=1 302 373 6.0E-07
sp|B3DZ87|RS15_METI4 30S ribosomal protein S15 OS=Methylacidiphilum infernorum (isolate V4) GN=rpsO PE=3 SV=1 302 358 6.0E-07
sp|Q3M438|RS15_ANAVT 30S ribosomal protein S15 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rpsO PE=3 SV=1 301 373 6.0E-07
sp|A9WPX3|RS15_RENSM 30S ribosomal protein S15 OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=rpsO PE=3 SV=1 300 373 6.0E-07
sp|B8EP10|RS15_METSB 30S ribosomal protein S15 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rpsO PE=3 SV=1 291 373 7.0E-07
sp|O66594|RS15_AQUAE 30S ribosomal protein S15 OS=Aquifex aeolicus (strain VF5) GN=rpsO PE=3 SV=1 282 373 7.0E-07
sp|A7I1V7|RS15_CAMHC 30S ribosomal protein S15 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=rpsO PE=3 SV=1 298 373 7.0E-07
sp|Q6AJY8|RS15_DESPS 30S ribosomal protein S15 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rpsO PE=3 SV=1 303 373 7.0E-07
sp|Q5WFU7|RS15_BACSK 30S ribosomal protein S15 OS=Bacillus clausii (strain KSM-K16) GN=rpsO PE=3 SV=1 302 373 7.0E-07
sp|Q493T4|RS15_BLOPB 30S ribosomal protein S15 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rpsO PE=3 SV=1 299 373 7.0E-07
sp|B9M1G4|RS15_GEODF 30S ribosomal protein S15 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rpsO PE=3 SV=1 303 373 7.0E-07
sp|Q4L5X6|RS15_STAHJ 30S ribosomal protein S15 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpsO PE=3 SV=1 302 373 7.0E-07
sp|B9LH02|RS15_CHLSY 30S ribosomal protein S15 OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rpsO PE=3 SV=1 302 373 7.0E-07
sp|A9WEJ6|RS15_CHLAA 30S ribosomal protein S15 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rpsO PE=3 SV=1 302 373 7.0E-07
sp|Q7U7F1|RS15_SYNPX 30S ribosomal protein S15 OS=Synechococcus sp. (strain WH8102) GN=rpsO PE=3 SV=1 301 373 7.0E-07
sp|A7H3P9|RS15_CAMJD 30S ribosomal protein S15 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=rpsO PE=3 SV=1 303 373 8.0E-07
sp|A5GF90|RS15_GEOUR 30S ribosomal protein S15 OS=Geobacter uraniireducens (strain Rf4) GN=rpsO PE=3 SV=1 303 373 8.0E-07
sp|P21473|RS15_BACSU 30S ribosomal protein S15 OS=Bacillus subtilis (strain 168) GN=rpsO PE=1 SV=4 302 373 8.0E-07
sp|A9HF29|RS15_GLUDA 30S ribosomal protein S15 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rpsO PE=3 SV=1 288 373 8.0E-07
sp|A7Z4T9|RS15_BACMF 30S ribosomal protein S15 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpsO PE=3 SV=1 302 373 8.0E-07
sp|Q7A116|RS15_STAAW 30S ribosomal protein S15 OS=Staphylococcus aureus (strain MW2) GN=rpsO PE=3 SV=1 302 373 8.0E-07
sp|A8Z3V3|RS15_STAAT 30S ribosomal protein S15 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rpsO PE=3 SV=1 302 373 8.0E-07
sp|Q6G9U0|RS15_STAAS 30S ribosomal protein S15 OS=Staphylococcus aureus (strain MSSA476) GN=rpsO PE=3 SV=1 302 373 8.0E-07
sp|Q6GHG2|RS15_STAAR 30S ribosomal protein S15 OS=Staphylococcus aureus (strain MRSA252) GN=rpsO PE=3 SV=1 302 373 8.0E-07
sp|Q7A5X8|RS15_STAAN 30S ribosomal protein S15 OS=Staphylococcus aureus (strain N315) GN=rpsO PE=1 SV=1 302 373 8.0E-07
sp|Q99UJ9|RS15_STAAM 30S ribosomal protein S15 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpsO PE=3 SV=1 302 373 8.0E-07
sp|A6QGH2|RS15_STAAE 30S ribosomal protein S15 OS=Staphylococcus aureus (strain Newman) GN=rpsO PE=3 SV=1 302 373 8.0E-07
sp|Q5HGF8|RS15_STAAC 30S ribosomal protein S15 OS=Staphylococcus aureus (strain COL) GN=rpsO PE=3 SV=1 302 373 8.0E-07
sp|Q2YXP3|RS15_STAAB 30S ribosomal protein S15 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpsO PE=3 SV=1 302 373 8.0E-07
sp|A5ISF7|RS15_STAA9 30S ribosomal protein S15 OS=Staphylococcus aureus (strain JH9) GN=rpsO PE=3 SV=1 302 373 8.0E-07
sp|Q2G2Q1|RS15_STAA8 30S ribosomal protein S15 OS=Staphylococcus aureus (strain NCTC 8325) GN=rpsO PE=3 SV=1 302 373 8.0E-07
sp|Q2FHG5|RS15_STAA3 30S ribosomal protein S15 OS=Staphylococcus aureus (strain USA300) GN=rpsO PE=3 SV=1 302 373 8.0E-07
sp|A6U192|RS15_STAA2 30S ribosomal protein S15 OS=Staphylococcus aureus (strain JH1) GN=rpsO PE=3 SV=1 302 373 8.0E-07
sp|A7X1Q7|RS15_STAA1 30S ribosomal protein S15 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rpsO PE=3 SV=1 302 373 8.0E-07
sp|Q9KA82|RS15_BACHD 30S ribosomal protein S15 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpsO PE=3 SV=1 303 373 9.0E-07
sp|A1R524|RS15_ARTAT 30S ribosomal protein S15 OS=Arthrobacter aurescens (strain TC1) GN=rpsO PE=3 SV=1 303 373 9.0E-07
sp|A7HZ96|RS15_PARL1 30S ribosomal protein S15 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpsO PE=3 SV=1 294 373 9.0E-07
sp|C5D9D4|RS15_GEOSW 30S ribosomal protein S15 OS=Geobacillus sp. (strain WCH70) GN=rpsO PE=3 SV=1 303 373 1.0E-06
sp|A0JUV7|RS15_ARTS2 30S ribosomal protein S15 OS=Arthrobacter sp. (strain FB24) GN=rpsO PE=3 SV=1 303 373 1.0E-06
sp|Q16CF2|RS15_ROSDO 30S ribosomal protein S15 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpsO PE=3 SV=1 294 373 1.0E-06
sp|A0Q0Q2|RS15_CLONN 30S ribosomal protein S15 OS=Clostridium novyi (strain NT) GN=rpsO PE=3 SV=1 294 373 1.0E-06
sp|B4U6R6|RS15_HYDS0 30S ribosomal protein S15 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=rpsO PE=3 SV=1 303 357 1.0E-06
sp|A8MFB3|RS15_ALKOO 30S ribosomal protein S15 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpsO PE=3 SV=1 303 373 1.0E-06
sp|Q8YYU7|RS15_NOSS1 30S ribosomal protein S15 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rpsO PE=3 SV=1 301 373 1.0E-06
sp|Q7VCI7|RS15_PROMA 30S ribosomal protein S15 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rpsO PE=3 SV=1 301 373 1.0E-06
sp|Q7TV07|RS15_PROMM 30S ribosomal protein S15 OS=Prochlorococcus marinus (strain MIT 9313) GN=rpsO PE=3 SV=1 301 373 1.0E-06
sp|A2CA19|RS15_PROM3 30S ribosomal protein S15 OS=Prochlorococcus marinus (strain MIT 9303) GN=rpsO PE=3 SV=1 301 373 1.0E-06
sp|Q8RA42|RS15_CALS4 30S ribosomal protein S15 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpsO PE=3 SV=1 302 373 1.0E-06
sp|Q12QH8|RS15_SHEDO 30S ribosomal protein S15 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpsO PE=3 SV=1 303 373 1.0E-06
sp|B5YHN1|RS15_THEYD 30S ribosomal protein S15 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rpsO PE=3 SV=1 303 373 1.0E-06
sp|Q46L69|RS15_PROMT 30S ribosomal protein S15 OS=Prochlorococcus marinus (strain NATL2A) GN=rpsO PE=3 SV=1 302 373 1.0E-06
sp|Q2RJM0|RS15_MOOTA 30S ribosomal protein S15 OS=Moorella thermoacetica (strain ATCC 39073) GN=rpsO PE=3 SV=1 303 373 1.0E-06
sp|Q086G9|RS15_SHEFN 30S ribosomal protein S15 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rpsO PE=3 SV=1 303 373 1.0E-06
sp|Q8RHN4|RS15_FUSNN 30S ribosomal protein S15 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rpsO PE=3 SV=1 302 373 1.0E-06
sp|Q2LWU2|RS15_SYNAS 30S ribosomal protein S15 OS=Syntrophus aciditrophicus (strain SB) GN=rpsO PE=3 SV=1 303 373 1.0E-06
sp|Q5N129|RS15_SYNP6 30S ribosomal protein S15 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rpsO PE=3 SV=2 302 373 1.0E-06
sp|Q31KU0|RS15_SYNE7 30S ribosomal protein S15 OS=Synechococcus elongatus (strain PCC 7942) GN=rpsO PE=3 SV=2 302 373 1.0E-06
sp|B1X416|RR15_PAUCH 30S ribosomal protein S15, organellar chromatophore OS=Paulinella chromatophora GN=rps15 PE=3 SV=1 302 373 2.0E-06
sp|B0THS1|RS15_HELMI 30S ribosomal protein S15 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpsO PE=3 SV=1 303 373 2.0E-06
sp|B1LBY1|RS15_THESQ 30S ribosomal protein S15 OS=Thermotoga sp. (strain RQ2) GN=rpsO PE=3 SV=1 303 373 2.0E-06
sp|A5IMM9|RS15_THEP1 30S ribosomal protein S15 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpsO PE=3 SV=1 303 373 2.0E-06
sp|Q9X165|RS15_THEMA 30S ribosomal protein S15 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsO PE=3 SV=1 303 373 2.0E-06
sp|A5CXD1|RS15_VESOH 30S ribosomal protein S15 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rpsO PE=3 SV=1 303 373 2.0E-06
sp|B1KWK2|RS15_CLOBM 30S ribosomal protein S15 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rpsO PE=3 SV=2 303 373 2.0E-06
sp|A7GG01|RS15_CLOBL 30S ribosomal protein S15 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rpsO PE=3 SV=2 303 373 2.0E-06
sp|B1II44|RS15_CLOBK 30S ribosomal protein S15 OS=Clostridium botulinum (strain Okra / Type B1) GN=rpsO PE=3 SV=2 303 373 2.0E-06
sp|A5I4I8|RS15_CLOBH 30S ribosomal protein S15 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rpsO PE=3 SV=1 303 373 2.0E-06
sp|A7FVY8|RS15_CLOB1 30S ribosomal protein S15 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rpsO PE=3 SV=2 303 373 2.0E-06
sp|A5FVN5|RS15_ACICJ 30S ribosomal protein S15 OS=Acidiphilium cryptum (strain JF-5) GN=rpsO PE=3 SV=1 303 373 2.0E-06
sp|A7H9F7|RS15_ANADF 30S ribosomal protein S15 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rpsO PE=3 SV=1 299 373 2.0E-06
sp|Q0AYI3|RS15_SYNWW 30S ribosomal protein S15 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpsO PE=3 SV=1 303 373 2.0E-06
sp|B6ENE5|RS15_ALISL 30S ribosomal protein S15 OS=Aliivibrio salmonicida (strain LFI1238) GN=rpsO PE=3 SV=1 303 373 2.0E-06
sp|B5FA82|RS15_VIBFM 30S ribosomal protein S15 OS=Vibrio fischeri (strain MJ11) GN=rpsO PE=3 SV=1 303 373 2.0E-06
sp|Q5E7L2|RS15_VIBF1 30S ribosomal protein S15 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpsO PE=3 SV=1 303 373 2.0E-06
sp|Q9RXH2|RS15_DEIRA 30S ribosomal protein S15 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rpsO PE=3 SV=1 300 373 2.0E-06
sp|C5C9T9|RS15_MICLC 30S ribosomal protein S15 OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=rpsO PE=3 SV=1 303 373 2.0E-06
sp|Q03QN2|RS15_LACBA 30S ribosomal protein S15 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpsO PE=3 SV=1 303 373 2.0E-06
sp|Q1RIG1|RS15_RICBR 30S ribosomal protein S15 OS=Rickettsia bellii (strain RML369-C) GN=rpsO PE=3 SV=1 303 373 3.0E-06
sp|A8GWV1|RS15_RICB8 30S ribosomal protein S15 OS=Rickettsia bellii (strain OSU 85-389) GN=rpsO PE=3 SV=1 303 373 3.0E-06
sp|Q74CT0|RS15_GEOSL 30S ribosomal protein S15 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rpsO PE=3 SV=1 303 373 3.0E-06
sp|B2ICY8|RS15_BEII9 30S ribosomal protein S15 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rpsO PE=3 SV=1 294 373 3.0E-06
sp|C4XJA5|RS15_DESMR 30S ribosomal protein S15 OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=rpsO PE=3 SV=1 303 373 3.0E-06
sp|Q6G5F7|RS15_BARHE 30S ribosomal protein S15 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpsO PE=3 SV=1 295 373 3.0E-06
sp|Q2GJV4|RS15_ANAPZ 30S ribosomal protein S15 OS=Anaplasma phagocytophilum (strain HZ) GN=rpsO PE=3 SV=1 303 373 3.0E-06
sp|A8Z661|RS15_SULMW 30S ribosomal protein S15 OS=Sulcia muelleri (strain GWSS) GN=rpsO PE=3 SV=1 303 357 3.0E-06
sp|A9BH72|RS15_PETMO 30S ribosomal protein S15 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rpsO PE=3 SV=1 303 356 3.0E-06
sp|B8G3Z0|RS15_CHLAD 30S ribosomal protein S15 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpsO PE=3 SV=1 302 373 3.0E-06
sp|A2C1Y4|RS15_PROM1 30S ribosomal protein S15 OS=Prochlorococcus marinus (strain NATL1A) GN=rpsO PE=3 SV=1 302 373 3.0E-06
sp|Q2RMR7|RS15_RHORT 30S ribosomal protein S15 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpsO PE=3 SV=1 303 373 3.0E-06
sp|B7VJH4|RS15_VIBTL 30S ribosomal protein S15 OS=Vibrio tasmaniensis (strain LGP32) GN=rpsO PE=3 SV=1 303 373 3.0E-06
sp|A6QBG2|RS15_SULNB 30S ribosomal protein S15 OS=Sulfurovum sp. (strain NBC37-1) GN=rpsO PE=3 SV=1 298 373 4.0E-06
sp|Q8EQT8|RS15_OCEIH 30S ribosomal protein S15 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpsO PE=3 SV=1 302 373 4.0E-06
sp|Q6LUI9|RS15_PHOPR 30S ribosomal protein S15 OS=Photobacterium profundum GN=rpsO PE=3 SV=1 303 373 4.0E-06
sp|B0Z4T2|RR15_OENAR 30S ribosomal protein S15, chloroplastic OS=Oenothera argillicola GN=rps15 PE=3 SV=1 303 377 4.0E-06
sp|A1SLJ5|RS15_NOCSJ 30S ribosomal protein S15 OS=Nocardioides sp. (strain BAA-499 / JS614) GN=rpsO PE=3 SV=1 303 373 4.0E-06
sp|A4IZA7|RS15_FRATW 30S ribosomal protein S15 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rpsO PE=3 SV=1 303 373 4.0E-06
sp|Q5NGX8|RS15_FRATT 30S ribosomal protein S15 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rpsO PE=3 SV=1 303 373 4.0E-06
sp|B2SDK9|RS15_FRATM 30S ribosomal protein S15 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rpsO PE=3 SV=1 303 373 4.0E-06
sp|Q14ID0|RS15_FRAT1 30S ribosomal protein S15 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rpsO PE=3 SV=1 303 373 4.0E-06
sp|A0Q5I8|RS15_FRATN 30S ribosomal protein S15 OS=Francisella tularensis subsp. novicida (strain U112) GN=rpsO PE=3 SV=1 303 373 5.0E-06
sp|B4UHG4|RS15_ANASK 30S ribosomal protein S15 OS=Anaeromyxobacter sp. (strain K) GN=rpsO PE=3 SV=1 295 373 5.0E-06
sp|Q2IQ02|RS15_ANADE 30S ribosomal protein S15 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rpsO PE=3 SV=1 295 373 5.0E-06
sp|B8JFZ0|RS15_ANAD2 30S ribosomal protein S15 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rpsO PE=3 SV=1 295 373 5.0E-06
sp|Q1DAM2|RS15_MYXXD 30S ribosomal protein S15 OS=Myxococcus xanthus (strain DK 1622) GN=rpsO PE=3 SV=1 302 373 5.0E-06
sp|B8HQI6|RS15_CYAP4 30S ribosomal protein S15 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=rpsO PE=3 SV=1 302 373 5.0E-06
sp|Q0BKU0|RS15_FRATO 30S ribosomal protein S15 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rpsO PE=3 SV=1 303 373 5.0E-06
sp|Q2A268|RS15_FRATH 30S ribosomal protein S15 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rpsO PE=3 SV=1 303 373 5.0E-06
sp|A7NDP4|RS15_FRATF 30S ribosomal protein S15 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rpsO PE=3 SV=1 303 373 5.0E-06
sp|Q8K9H4|RS15_BUCAP 30S ribosomal protein S15 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rpsO PE=3 SV=1 303 373 5.0E-06
sp|O86655|RS15_STRCO 30S ribosomal protein S15 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rpsO PE=3 SV=1 303 373 5.0E-06
sp|B2USP1|RS15_HELPS 30S ribosomal protein S15 OS=Helicobacter pylori (strain Shi470) GN=rpsO PE=3 SV=1 303 373 5.0E-06
sp|A1A007|RS15_BIFAA 30S ribosomal protein S15 OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=rpsO PE=3 SV=1 303 373 5.0E-06
sp|B2A3A2|RS15_NATTJ 30S ribosomal protein S15 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rpsO PE=3 SV=1 303 373 5.0E-06
sp|A8GS97|RS15_RICRS 30S ribosomal protein S15 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rpsO PE=3 SV=1 303 373 6.0E-06
sp|B0BXR1|RS15_RICRO 30S ribosomal protein S15 OS=Rickettsia rickettsii (strain Iowa) GN=rpsO PE=3 SV=1 303 373 6.0E-06
sp|C4K0F3|RS15_RICPU 30S ribosomal protein S15 OS=Rickettsia peacockii (strain Rustic) GN=rpsO PE=3 SV=1 303 373 6.0E-06
sp|A8F1P4|RS15_RICM5 30S ribosomal protein S15 OS=Rickettsia massiliae (strain Mtu5) GN=rpsO PE=3 SV=2 303 373 6.0E-06
sp|Q92HV6|RS15_RICCN 30S ribosomal protein S15 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rpsO PE=3 SV=1 303 373 6.0E-06
sp|C3PNK3|RS15_RICAE 30S ribosomal protein S15 OS=Rickettsia africae (strain ESF-5) GN=rpsO PE=3 SV=1 303 373 6.0E-06
sp|A0AID1|RS15_LISW6 30S ribosomal protein S15 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpsO PE=3 SV=1 302 373 6.0E-06
sp|Q92C24|RS15_LISMO 30S ribosomal protein S15 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpsO PE=3 SV=1 302 373 6.0E-06
sp|B8DFZ7|RS15_LISMH 30S ribosomal protein S15 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rpsO PE=3 SV=1 302 373 6.0E-06
sp|Q71ZZ2|RS15_LISMF 30S ribosomal protein S15 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpsO PE=3 SV=1 302 373 6.0E-06
sp|C1L2N6|RS15_LISMC 30S ribosomal protein S15 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rpsO PE=3 SV=1 302 373 6.0E-06
sp|Q7ANZ1|RS15_LISIN 30S ribosomal protein S15 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpsO PE=3 SV=1 302 373 6.0E-06
sp|B8DVV7|RS15_BIFA0 30S ribosomal protein S15 OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=rpsO PE=3 SV=1 303 373 6.0E-06
sp|Q2JR73|RS15_SYNJA 30S ribosomal protein S15 OS=Synechococcus sp. (strain JA-3-3Ab) GN=rpsO PE=3 SV=1 303 373 6.0E-06
sp|Q83G93|RS15_TROWT 30S ribosomal protein S15 OS=Tropheryma whipplei (strain Twist) GN=rpsO PE=3 SV=2 303 373 7.0E-06
sp|Q83HX8|RS15_TROW8 30S ribosomal protein S15 OS=Tropheryma whipplei (strain TW08/27) GN=rpsO PE=3 SV=1 303 373 7.0E-06
sp|Q3SWP6|RS15_NITWN 30S ribosomal protein S15 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpsO PE=3 SV=1 303 373 8.0E-06
sp|B0TZ10|RS15_FRAP2 30S ribosomal protein S15 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rpsO PE=3 SV=1 303 373 8.0E-06
sp|Q8NP49|RS15_CORGL 30S ribosomal protein S15 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=rpsO PE=3 SV=1 270 373 8.0E-06
sp|A4QEY3|RS15_CORGB 30S ribosomal protein S15 OS=Corynebacterium glutamicum (strain R) GN=rpsO PE=3 SV=1 270 373 8.0E-06
sp|Q0SSD9|RS15_CLOPS 30S ribosomal protein S15 OS=Clostridium perfringens (strain SM101 / Type A) GN=rpsO PE=3 SV=1 303 373 8.0E-06
sp|Q8XJS3|RS15_CLOPE 30S ribosomal protein S15 OS=Clostridium perfringens (strain 13 / Type A) GN=rpsO PE=3 SV=1 303 373 8.0E-06
sp|Q0TPS2|RS15_CLOP1 30S ribosomal protein S15 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpsO PE=3 SV=1 303 373 8.0E-06
sp|A5GKN0|RS15_SYNPW 30S ribosomal protein S15 OS=Synechococcus sp. (strain WH7803) GN=rpsO PE=3 SV=1 302 373 8.0E-06
sp|B7GNH3|RS15_BIFLS 30S ribosomal protein S15 OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=rpsO PE=3 SV=1 303 373 9.0E-06
sp|Q7M9B0|RS15_WOLSU 30S ribosomal protein S15 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpsO PE=3 SV=1 298 373 9.0E-06
sp|C0R3T5|RS15_WOLWR 30S ribosomal protein S15 OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=rpsO PE=3 SV=1 303 373 9.0E-06
sp|Q8G448|RS15_BIFLO 30S ribosomal protein S15 OS=Bifidobacterium longum (strain NCC 2705) GN=rpsO PE=3 SV=1 303 373 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:0043043 peptide biosynthetic process No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0006518 peptide metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0005198 structural molecule activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043228 non-membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0043603 cellular amide metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3527
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|8
Ophiocordyceps australis map64 (Brazil) OphauB2|6153
Ophiocordyceps camponoti-floridani Ophcf2|05791
Ophiocordyceps camponoti-rufipedis Ophun1|3743 (this protein)
Ophiocordyceps kimflemingae Ophio5|7167
Ophiocordyceps subramaniannii Hirsu2|6771

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3743
MPPRIGALQRLSTVKLFDASTAARLLPVVQAASLSKREKAEKMKKIRRLDPYRQEQIEQRKNAHNARKEILKQQR
AAEWGHPVWGAPTPTPFAESLMSGGQQPFSVVNQEPASEDGDGSGDGPAGEASGDAVVSSSSSSSETQADVVSSS
SPEGEASSGNPKSESANTDAKDGAVSAPQQVRELPTSLHLRNYYVTEEEFEENLKYAYDLTKPRESIIKEALLQS
DEYPPDPKERSHDENHERARLAMQRILAIEHASGKNIFHINVGRILEKFGRHETDKFLAPKPVGITKPREPAPRG
GPDTGSSEVQIAILTAKIRKLATMLQSKDSRKDKHNRKHLRTLVHRRQKLLKYLKKKERGGGRWTHLIEELGLTP
ATWEGEITI*
Coding >Ophun1|3743
ATGCCGCCGAGAATAGGGGCGCTTCAGCGTCTGTCGACCGTCAAGCTCTTCGACGCTTCTACGGCCGCTCGGTTG
CTGCCCGTGGTGCAAGCGGCTAGCCTTTCGAAACGCGAAAAGGCGGAGAAGATGAAGAAGATTAGAAGACTGGAC
CCCTACCGACAGGAACAGATCGAGCAGCGCAAGAACGCCCACAACGCGCGCAAAGAGATTCTCAAGCAGCAGCGC
GCCGCGGAATGGGGCCATCCCGTCTGGGGGGCGCCGACGCCGACGCCTTTTGCAGAGTCTCTGATGTCGGGTGGA
CAGCAGCCATTCTCTGTCGTCAATCAAGAGCCGGCGAGCGAAGATGGCGATGGCTCTGGTGACGGTCCCGCCGGT
GAGGCGTCAGGGGACGCCGTTGTCAGCAGTAGCAGTTCCAGCAGTGAGACTCAAGCGGATGTCGTCTCCAGCAGC
AGCCCCGAAGGCGAGGCCAGCAGCGGCAACCCCAAAAGCGAGTCCGCCAACACCGATGCCAAAGACGGAGCCGTC
TCTGCCCCCCAACAAGTCCGCGAGCTGCCAACCTCCCTTCACCTTCGCAACTACTACGTCACCGAGGAAGAATTC
GAAGAAAACCTCAAATACGCCTACGACCTCACCAAGCCGAGAGAATCCATAATAAAAGAAGCCCTCCTCCAGTCA
GACGAATATCCGCCCGACCCCAAAGAAAGAAGCCACGACGAGAATCACGAGCGGGCAAGGCTGGCCATGCAGCGC
ATTCTGGCCATCGAACACGCCAGCGGCAAGAACATCTTTCACATAAACGTCGGGCGCATACTCGAGAAGTTCGGC
CGCCACGAGACGGACAAGTTCCTTGCGCCTAAACCGGTCGGCATCACCAAACCCCGCGAGCCCGCCCCGCGTGGA
GGTCCGGACACGGGCAGCTCCGAGGTGCAGATTGCCATCCTCACCGCGAAAATCAGGAAGCTCGCTACCATGCTG
CAGAGCAAGGATAGCCGCAAAGACAAGCACAACAGGAAGCACCTGAGGACGCTCGTCCATCGCCGGCAGAAGCTG
CTAAAGTATCTGAAAAAGAAGGAAAGGGGGGGCGGTCGTTGGACACACTTGATTGAGGAGCTGGGTCTCACGCCG
GCCACTTGGGAGGGAGAAATCACCATCTAG
Transcript >Ophun1|3743
ATGCCGCCGAGAATAGGGGCGCTTCAGCGTCTGTCGACCGTCAAGCTCTTCGACGCTTCTACGGCCGCTCGGTTG
CTGCCCGTGGTGCAAGCGGCTAGCCTTTCGAAACGCGAAAAGGCGGAGAAGATGAAGAAGATTAGAAGACTGGAC
CCCTACCGACAGGAACAGATCGAGCAGCGCAAGAACGCCCACAACGCGCGCAAAGAGATTCTCAAGCAGCAGCGC
GCCGCGGAATGGGGCCATCCCGTCTGGGGGGCGCCGACGCCGACGCCTTTTGCAGAGTCTCTGATGTCGGGTGGA
CAGCAGCCATTCTCTGTCGTCAATCAAGAGCCGGCGAGCGAAGATGGCGATGGCTCTGGTGACGGTCCCGCCGGT
GAGGCGTCAGGGGACGCCGTTGTCAGCAGTAGCAGTTCCAGCAGTGAGACTCAAGCGGATGTCGTCTCCAGCAGC
AGCCCCGAAGGCGAGGCCAGCAGCGGCAACCCCAAAAGCGAGTCCGCCAACACCGATGCCAAAGACGGAGCCGTC
TCTGCCCCCCAACAAGTCCGCGAGCTGCCAACCTCCCTTCACCTTCGCAACTACTACGTCACCGAGGAAGAATTC
GAAGAAAACCTCAAATACGCCTACGACCTCACCAAGCCGAGAGAATCCATAATAAAAGAAGCCCTCCTCCAGTCA
GACGAATATCCGCCCGACCCCAAAGAAAGAAGCCACGACGAGAATCACGAGCGGGCAAGGCTGGCCATGCAGCGC
ATTCTGGCCATCGAACACGCCAGCGGCAAGAACATCTTTCACATAAACGTCGGGCGCATACTCGAGAAGTTCGGC
CGCCACGAGACGGACAAGTTCCTTGCGCCTAAACCGGTCGGCATCACCAAACCCCGCGAGCCCGCCCCGCGTGGA
GGTCCGGACACGGGCAGCTCCGAGGTGCAGATTGCCATCCTCACCGCGAAAATCAGGAAGCTCGCTACCATGCTG
CAGAGCAAGGATAGCCGCAAAGACAAGCACAACAGGAAGCACCTGAGGACGCTCGTCCATCGCCGGCAGAAGCTG
CTAAAGTATCTGAAAAAGAAGGAAAGGGGGGGCGGTCGTTGGACACACTTGATTGAGGAGCTGGGTCTCACGCCG
GCCACTTGGGAGGGAGAAATCACCATCTAG
Gene >Ophun1|3743
ATGCCGCCGAGAATAGGGGCGCTTCAGCGTCTGTCGACCGTCAAGCGTAGGAGATCACCGTCCCGACCTCTCCGT
CATACGCATCGCAATGGCTGACAATATCCGTCTCTCTTCCAAGTCTTCGACGCTTCTACGGCCGCTCGGTTGCTG
CCCGTGGTGCAAGCGGCTAGCCTTTCGAAACGCGAAAAGGCGGAGAAGATGAAGAAGATTAGAAGACTGGACCCC
TACCGACAGGAACAGATCGAGCAGCGCAAGAACGCCCACAACGCGCGCAAAGAGATTCTCAAGCAGCAGCGCGCC
GCGGAATGGGGCCATCCCGTCTGGGGGGCGCCGACGCCGACGCCTTTTGCAGAGTCTCTGATGTCGGGTGGACAG
CAGCCATTCTCTGTCGTCAATCAAGAGCCGGCGAGCGAAGATGGCGATGGCTCTGGTGACGGTCCCGCCGGTGAG
GCGTCAGGGGACGCCGTTGTCAGCAGTAGCAGTTCCAGCAGTGAGACTCAAGCGGATGTCGTCTCCAGCAGCAGC
CCCGAAGGCGAGGCCAGCAGCGGCAACCCCAAAAGCGAGTCCGCCAACACCGATGCCAAAGACGGAGCCGTCTCT
GCCCCCCAACAAGTCCGCGAGCTGCCAACCTCCCTTCACCTTCGCAACTACTACGTCACCGAGGAAGAATTCGAA
GAAAACCTCAAATACGCCTACGACCTCACCAAGCCGAGAGAATCCATAATAAAAGAAGCCCTCCTCCAGTCAGAC
GAATATCCGCCCGACCCCAAAGAAAGAAGCCACGACGAGAATCACGAGCGGGCAAGGCTGGCCATGCAGCGCATT
CTGGCCATCGAACACGCCAGCGGCAAGAACATCTTTCACATAAACGTCGGGCGCATACTCGAGAAGTTCGGCCGC
CACGAGACGGACAAGTTCCTTGCGCCTAAACCGGTCGGCATCACCAAACCCCGCGAGCCCGCCCCGCGTGGAGGT
CCGGACACGGGCAGCTCCGAGGTGCAGATTGCCATCCTCACCGCGAAAATCAGGAAGCTCGCTACCATGCTGCAG
AGCAAGGATAGCCGCAAAGACAAGCACAACAGGAAGCACCTGAGGACGCTCGTCCATCGCCGGCAGAAGCTGCTA
AAGTATCTGAAAAAGAAGGAAAGGGGGGGCGGTCGTTGGACACACTTGATTGAGGAGCTGGGTCTCACGCCGGCC
ACTTGGGAGGGAGAAATCACCATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail