Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3742
Gene name
LocationContig_336:11677..12652
Strand-
Gene length (bp)975
Transcript length (bp)873
Coding sequence length (bp)873
Protein length (aa) 291

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00318 Ribosomal_S2 Ribosomal protein S2 1.1E-08 20 115
PF00318 Ribosomal_S2 Ribosomal protein S2 6.2E-14 118 184

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C7Z0Q8|RSSA_NECH7 40S ribosomal protein S0 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=RPS0 PE=3 SV=1 1 278 2.0E-159
sp|A4R188|RSSA_MAGO7 40S ribosomal protein S0 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RPS0 PE=3 SV=1 1 285 2.0E-153
sp|Q01291|RSSA_NEUCR 40S ribosomal protein S0 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rps-0 PE=3 SV=2 1 287 5.0E-148
sp|Q0UR95|RSSA_PHANO 40S ribosomal protein S0 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RPS0 PE=3 SV=2 1 290 2.0E-145
sp|Q2GV75|RSSA_CHAGB 40S ribosomal protein S0 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RPS0 PE=3 SV=1 1 287 3.0E-145
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C7Z0Q8|RSSA_NECH7 40S ribosomal protein S0 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=RPS0 PE=3 SV=1 1 278 2.0E-159
sp|A4R188|RSSA_MAGO7 40S ribosomal protein S0 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RPS0 PE=3 SV=1 1 285 2.0E-153
sp|Q01291|RSSA_NEUCR 40S ribosomal protein S0 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rps-0 PE=3 SV=2 1 287 5.0E-148
sp|Q0UR95|RSSA_PHANO 40S ribosomal protein S0 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RPS0 PE=3 SV=2 1 290 2.0E-145
sp|Q2GV75|RSSA_CHAGB 40S ribosomal protein S0 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RPS0 PE=3 SV=1 1 287 3.0E-145
sp|A7F2R3|RSSA_SCLS1 40S ribosomal protein S0 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rps0 PE=3 SV=1 1 278 5.0E-145
sp|B2VY36|RSSA_PYRTR 40S ribosomal protein S0 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=rps0 PE=3 SV=1 1 278 2.0E-143
sp|Q4WYK1|RSSA_ASPFU 40S ribosomal protein S0 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rps0 PE=3 SV=1 1 272 2.0E-143
sp|B0XWG9|RSSA_ASPFC 40S ribosomal protein S0 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=rps0 PE=3 SV=1 1 272 2.0E-143
sp|B2B1Z3|RSSA_PODAN 40S ribosomal protein S0 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=RPS0 PE=3 SV=1 1 287 3.0E-143
sp|A1CL63|RSSA_ASPCL 40S ribosomal protein S0 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rps0 PE=3 SV=1 1 272 3.0E-143
sp|A6RMY2|RSSA_BOTFB 40S ribosomal protein S0 OS=Botryotinia fuckeliana (strain B05.10) GN=rps0 PE=3 SV=1 1 273 6.0E-143
sp|B8M6L1|RSSA_TALSN 40S ribosomal protein S0 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=rps0 PE=3 SV=1 1 232 7.0E-143
sp|B6Q3G2|RSSA_TALMQ 40S ribosomal protein S0 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=rps0 PE=3 SV=1 1 232 9.0E-143
sp|A1D695|RSSA_NEOFI 40S ribosomal protein S0 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rps0 PE=3 SV=1 1 272 1.0E-142
sp|C1G1P4|RSSA_PARBD 40S ribosomal protein S0 OS=Paracoccidioides brasiliensis (strain Pb18) GN=RPS0 PE=3 SV=1 1 290 8.0E-142
sp|C0S3U2|RSSA_PARBP 40S ribosomal protein S0 OS=Paracoccidioides brasiliensis (strain Pb03) GN=RPS0 PE=3 SV=1 1 290 2.0E-141
sp|C1GUB6|RSSA_PARBA 40S ribosomal protein S0 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=RPS0 PE=3 SV=1 1 290 2.0E-141
sp|B6H2I7|RSSA_PENRW 40S ribosomal protein S0 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=rps0 PE=3 SV=1 1 290 2.0E-140
sp|Q5B8F8|RSSA_EMENI 40S ribosomal protein S0 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rps0 PE=3 SV=2 1 290 5.0E-140
sp|C5PA09|RSSA_COCP7 40S ribosomal protein S0 OS=Coccidioides posadasii (strain C735) GN=RPS0 PE=3 SV=1 1 282 1.0E-139
sp|Q1E1R2|RSSA_COCIM 40S ribosomal protein S0 OS=Coccidioides immitis (strain RS) GN=RPS0 PE=3 SV=1 1 282 1.0E-139
sp|C4JYP8|RSSA_UNCRE 40S ribosomal protein S0 OS=Uncinocarpus reesii (strain UAMH 1704) GN=RPS0 PE=3 SV=1 1 282 1.0E-138
sp|Q0CQF6|RSSA_ASPTN 40S ribosomal protein S0 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rps0 PE=3 SV=1 1 248 6.0E-138
sp|Q2UBZ9|RSSA_ASPOR 40S ribosomal protein S0 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rps0 PE=3 SV=1 1 255 2.0E-137
sp|B8N513|RSSA_ASPFN 40S ribosomal protein S0 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rps0 PE=3 SV=1 1 255 2.0E-137
sp|C0NKW7|RSSA_AJECG 40S ribosomal protein S0 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=RPS0 PE=3 SV=1 1 282 3.0E-137
sp|C5FD74|RSSA_ARTOC 40S ribosomal protein S0 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=RPS0 PE=3 SV=1 1 290 3.0E-136
sp|A2QE32|RSSA_ASPNC 40S ribosomal protein S0 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rps0 PE=3 SV=1 1 272 4.0E-134
sp|C5JKQ2|RSSA_AJEDS 40S ribosomal protein S0 OS=Ajellomyces dermatitidis (strain SLH14081) GN=RPS0 PE=3 SV=1 1 244 6.0E-130
sp|C5G8P1|RSSA_AJEDR 40S ribosomal protein S0 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=RPS0 PE=3 SV=1 1 244 6.0E-130
sp|A8N7C6|RSSA_COPC7 40S ribosomal protein S0 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=RPS0 PE=3 SV=1 4 283 5.0E-117
sp|B6K2L2|RSSA3_SCHJY 40S ribosomal protein S0-C OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=rps0c PE=3 SV=1 7 210 2.0E-116
sp|B0D174|RSSA_LACBS 40S ribosomal protein S0 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=RPS0 PE=3 SV=1 4 250 9.0E-116
sp|B6K180|RSSA1_SCHJY 40S ribosomal protein S0-A OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=rps0a PE=3 SV=1 1 210 2.0E-115
sp|Q6CN12|RSSA_KLULA 40S ribosomal protein S0 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RPS0 PE=1 SV=1 5 237 3.0E-115
sp|B6K1S2|RSSA2_SCHJY 40S ribosomal protein S0-B OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=rps0b PE=3 SV=1 7 210 4.0E-115
sp|A3LRZ0|RSSA_PICST 40S ribosomal protein S0 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RPS0 PE=3 SV=1 5 242 1.0E-114
sp|C5DDM1|RSSA_LACTC 40S ribosomal protein S0 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=RPS0 PE=3 SV=1 5 211 1.0E-113
sp|B8PAR0|RSSA_POSPM 40S ribosomal protein S0 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=RPS0 PE=3 SV=1 4 286 1.0E-113
sp|A5DZP6|RSSA_LODEL 40S ribosomal protein S0 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RPS0 PE=3 SV=1 5 211 1.0E-112
sp|Q6BW39|RSSA_DEBHA 40S ribosomal protein S0 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPS0 PE=3 SV=3 5 229 2.0E-112
sp|C4Y2C6|RSSA_CLAL4 40S ribosomal protein S0 OS=Clavispora lusitaniae (strain ATCC 42720) GN=RPS0 PE=3 SV=1 5 220 2.0E-112
sp|Q9Y7L8|RSSA1_SCHPO 40S ribosomal protein S0-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps001 PE=1 SV=1 1 282 3.0E-112
sp|A5DGG9|RSSA_PICGU 40S ribosomal protein S0 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RPS0 PE=3 SV=1 5 229 3.0E-112
sp|C4YNR7|RSSA_CANAW 40S ribosomal protein S0 OS=Candida albicans (strain WO-1) GN=RPS0 PE=3 SV=1 5 211 2.0E-111
sp|O42817|RSSA_CANAL 40S ribosomal protein S0 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS0 PE=2 SV=2 5 211 2.0E-111
sp|A7TEU3|RSSA1_VANPO 40S ribosomal protein S0-A OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RPS0A PE=3 SV=1 5 238 8.0E-111
sp|Q75CQ9|RSSA_ASHGO 40S ribosomal protein S0 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPS0 PE=3 SV=1 5 210 9.0E-111
sp|B9WEC5|RSSA_CANDC 40S ribosomal protein S0 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=RPS0 PE=3 SV=1 5 216 1.0E-110
sp|C5DX17|RSSA_ZYGRC 40S ribosomal protein S0 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=RPS0 PE=3 SV=1 5 217 1.0E-110
sp|Q01661|RSSA_PNECA 40S ribosomal protein S0 OS=Pneumocystis carinii GN=RPS0 PE=2 SV=1 16 286 2.0E-110
sp|Q9P546|RSSA2_SCHPO 40S ribosomal protein S0-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps002 PE=1 SV=1 7 210 3.0E-110
sp|Q96VK7|RSSA_CANTR 40S ribosomal protein S0 OS=Candida tropicalis GN=RPS0 PE=3 SV=1 5 211 2.0E-109
sp|A7TIJ7|RSSA2_VANPO 40S ribosomal protein S0-B OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RPS0B PE=3 SV=1 5 210 3.0E-109
sp|C4QYK0|RSSA_PICPG 40S ribosomal protein S0 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=RPS0 PE=3 SV=1 5 210 5.0E-109
sp|Q6FJX4|RSSA_CANGA 40S ribosomal protein S0 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPS0 PE=3 SV=1 5 211 2.0E-108
sp|P32905|RSSA1_YEAST 40S ribosomal protein S0-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS0A PE=1 SV=3 5 210 2.0E-107
sp|A6ZUM5|RSSA1_YEAS7 40S ribosomal protein S0-A OS=Saccharomyces cerevisiae (strain YJM789) GN=RPS0A PE=3 SV=1 5 210 2.0E-107
sp|B3LI22|RSSA1_YEAS1 40S ribosomal protein S0-A OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RPS0A PE=3 SV=1 5 210 2.0E-107
sp|Q6CGM0|RSSA_YARLI 40S ribosomal protein S0 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPS0 PE=3 SV=2 9 209 2.0E-107
sp|P46654|RSSA2_YEAST 40S ribosomal protein S0-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS0B PE=1 SV=2 5 210 9.0E-107
sp|A7A0V3|RSSA2_YEAS7 40S ribosomal protein S0-B OS=Saccharomyces cerevisiae (strain YJM789) GN=RPS0B PE=3 SV=1 5 210 9.0E-107
sp|B3LT19|RSSA2_YEAS1 40S ribosomal protein S0-B OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RPS0B PE=3 SV=1 5 210 9.0E-107
sp|P0CQ56|RSSA_CRYNJ 40S ribosomal protein S0 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RPS0 PE=3 SV=1 1 210 6.0E-105
sp|P0CQ57|RSSA_CRYNB 40S ribosomal protein S0 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RPS0 PE=3 SV=1 1 210 6.0E-105
sp|A8PXY6|RSSA_MALGO 40S ribosomal protein S0 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=RPS0 PE=3 SV=1 4 218 7.0E-104
sp|P14206|RSSA_MOUSE 40S ribosomal protein SA OS=Mus musculus GN=Rpsa PE=1 SV=4 9 290 1.0E-99
sp|P26452|RSSA_BOVIN 40S ribosomal protein SA OS=Bos taurus GN=RPSA PE=2 SV=4 9 290 1.0E-99
sp|P38983|RSSA_RAT 40S ribosomal protein SA OS=Rattus norvegicus GN=Rpsa PE=1 SV=3 9 290 1.0E-99
sp|Q3ZM03|RSSA_XENLA 40S ribosomal protein SA OS=Xenopus laevis GN=rpsa PE=1 SV=1 9 257 2.0E-99
sp|Q6P8D1|RSSA_XENTR 40S ribosomal protein SA OS=Xenopus tropicalis GN=rpsa PE=2 SV=1 9 257 3.0E-99
sp|A6YRY8|RSSA_SHEEP 40S ribosomal protein SA OS=Ovis aries GN=RPSA PE=2 SV=1 9 290 3.0E-99
sp|Q2L9X0|RSSA_CHLAE 40S ribosomal protein SA OS=Chlorocebus aethiops GN=RPSA PE=2 SV=3 9 290 4.0E-99
sp|P08865|RSSA_HUMAN 40S ribosomal protein SA OS=Homo sapiens GN=RPSA PE=1 SV=4 9 290 5.0E-99
sp|Q4GWZ2|RSSA_PIG 40S ribosomal protein SA OS=Sus scrofa GN=RPSA PE=1 SV=3 9 290 8.0E-99
sp|P38982|RSSA_CRIGR 40S ribosomal protein SA OS=Cricetulus griseus GN=Rpsa PE=1 SV=3 9 290 1.0E-98
sp|B3RPX6|RSSA_TRIAD 40S ribosomal protein SA OS=Trichoplax adhaerens GN=TRIADDRAFT_49917 PE=3 SV=1 9 280 2.0E-98
sp|Q4P426|RSSA_USTMA 40S ribosomal protein S0 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RPS0 PE=3 SV=1 4 288 3.0E-98
sp|Q4QY71|RSSA_SPAAU 40S ribosomal protein SA OS=Sparus aurata GN=rpsa PE=2 SV=2 9 257 4.0E-97
sp|A7RKS5|RSSA_NEMVE 40S ribosomal protein SA OS=Nematostella vectensis GN=v1g198553 PE=3 SV=1 9 290 1.0E-96
sp|P50890|RSSA_CHICK 40S ribosomal protein SA OS=Gallus gallus GN=RPSA PE=3 SV=1 9 290 2.0E-96
sp|A2Q0U8|RSSA_SOLSE 40S ribosomal protein SA OS=Solea senegalensis GN=rpsa PE=2 SV=1 9 257 2.0E-96
sp|B5FXT6|RSSA_TAEGU 40S ribosomal protein SA OS=Taeniopygia guttata GN=RPSA PE=2 SV=1 9 290 2.0E-96
sp|B5DGB6|RSSA_SALSA 40S ribosomal protein SA OS=Salmo salar GN=rpsa PE=2 SV=1 9 257 3.0E-96
sp|Q803F6|RSSA_DANRE 40S ribosomal protein SA OS=Danio rerio GN=rpsa PE=2 SV=1 9 257 4.0E-96
sp|Q90YS4|RSSA_ICTPU 40S ribosomal protein SA OS=Ictalurus punctatus GN=rpsa PE=2 SV=1 9 247 3.0E-95
sp|Q4KTE2|RSSA_SUBDO 40S ribosomal protein SA OS=Suberites domuncula PE=2 SV=1 9 269 4.0E-95
sp|A9UPA2|RSSA_MONBE 40S ribosomal protein SA OS=Monosiga brevicollis GN=30792 PE=3 SV=1 9 278 6.0E-95
sp|P38984|RSSA_HYDVD 40S ribosomal protein SA OS=Hydra viridissima PE=2 SV=1 10 281 2.0E-92
sp|Q5UAP4|RSSA_BOMMO 40S ribosomal protein SA OS=Bombyx mori PE=2 SV=1 9 242 1.0E-91
sp|Q0PXX8|RSSA_DIACI 40S ribosomal protein SA OS=Diaphorina citri PE=2 SV=1 9 229 2.0E-91
sp|P38980|RSSA_TRIGR 40S ribosomal protein SA OS=Tripneustes gratilla PE=2 SV=1 16 247 4.0E-90
sp|A6NA00|RSSA_ORNPR 40S ribosomal protein SA OS=Ornithodoros parkeri PE=2 SV=1 8 218 2.0E-89
sp|Q8MPF7|RSSA_TOXGO 40S ribosomal protein SA OS=Toxoplasma gondii PE=2 SV=1 10 242 4.0E-89
sp|B3P9J3|RSSA_DROER 40S ribosomal protein SA OS=Drosophila erecta GN=sta PE=3 SV=1 9 210 5.0E-89
sp|B4PY37|RSSA_DROYA 40S ribosomal protein SA OS=Drosophila yakuba GN=sta PE=2 SV=1 9 210 6.0E-89
sp|Q0H6L0|RSSA_DROTE 40S ribosomal protein SA OS=Drosophila teissieri GN=sta PE=3 SV=1 9 210 6.0E-89
sp|Q0H6L1|RSSA_DROSI 40S ribosomal protein SA OS=Drosophila simulans GN=sta PE=3 SV=1 9 210 6.0E-89
sp|B4I9F6|RSSA_DROSE 40S ribosomal protein SA OS=Drosophila sechellia GN=sta PE=3 SV=1 9 210 6.0E-89
sp|Q9ZSR8|RSSA_BRANA 40S ribosomal protein SA OS=Brassica napus GN=LRP PE=2 SV=1 4 272 7.0E-89
sp|O80377|RSSA_DAUCA 40S ribosomal protein SA OS=Daucus carota GN=179B PE=2 SV=1 10 268 1.0E-88
sp|B4JXG8|RSSA_DROGR 40S ribosomal protein SA OS=Drosophila grimshawi GN=sta PE=3 SV=1 9 210 3.0E-88
sp|B4MB32|RSSA_DROVI 40S ribosomal protein SA OS=Drosophila virilis GN=sta PE=3 SV=1 9 210 3.0E-88
sp|B4L760|RSSA_DROMO 40S ribosomal protein SA OS=Drosophila mojavensis GN=sta PE=3 SV=1 9 210 3.0E-88
sp|A3RLT6|RSSA_PINFU 40S ribosomal protein SA OS=Pinctada fucata PE=2 SV=1 9 238 3.0E-88
sp|A4RUK2|RSSA_OSTLU 40S ribosomal protein SA OS=Ostreococcus lucimarinus (strain CCE9901) GN=OSTLU_12355 PE=3 SV=1 1 271 5.0E-88
sp|Q8H173|RSSA2_ARATH 40S ribosomal protein Sa-2 OS=Arabidopsis thaliana GN=RPSaB PE=1 SV=2 16 226 6.0E-88
sp|P38979|RSSA_DROME 40S ribosomal protein SA OS=Drosophila melanogaster GN=sta PE=1 SV=2 9 210 8.0E-88
sp|B3MRX2|RSSA_DROAN 40S ribosomal protein SA OS=Drosophila ananassae GN=sta PE=3 SV=1 9 210 8.0E-88
sp|B4NPT0|RSSA_DROWI 40S ribosomal protein SA OS=Drosophila willistoni GN=sta PE=3 SV=1 9 210 1.0E-87
sp|O65751|RSSA_CICAR 40S ribosomal protein SA OS=Cicer arietinum GN=RAP40 PE=2 SV=1 1 258 2.0E-87
sp|Q08682|RSSA1_ARATH 40S ribosomal protein Sa-1 OS=Arabidopsis thaliana GN=RPSaA PE=1 SV=3 10 241 2.0E-87
sp|Q29J14|RSSA_DROPS 40S ribosomal protein SA OS=Drosophila pseudoobscura pseudoobscura GN=sta PE=3 SV=2 9 210 3.0E-87
sp|B4GTK1|RSSA_DROPE 40S ribosomal protein SA OS=Drosophila persimilis GN=sta PE=3 SV=1 9 210 3.0E-87
sp|A8IB25|RSSA_CHLRE 40S ribosomal protein SA OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_126059 PE=3 SV=1 10 208 3.0E-87
sp|Q01CH5|RSSA_OSTTA 40S ribosomal protein SA OS=Ostreococcus tauri GN=Ot03g03240 PE=3 SV=2 1 210 2.0E-86
sp|A5BUU4|RSSA_VITVI 40S ribosomal protein SA OS=Vitis vinifera GN=GSVIVT00034021001 PE=3 SV=1 10 271 2.0E-86
sp|Q7PZ81|RSSA_ANOGA 40S ribosomal protein SA OS=Anopheles gambiae GN=AGAP011777 PE=3 SV=3 9 220 3.0E-86
sp|O22518|RSSA_SOYBN 40S ribosomal protein SA OS=Glycine max PE=2 SV=1 7 208 7.0E-86
sp|P46769|RSSA_CAEEL 40S ribosomal protein SA OS=Caenorhabditis elegans GN=rps-0 PE=1 SV=3 13 255 9.0E-86
sp|Q16ZR8|RSSA_AEDAE 40S ribosomal protein SA OS=Aedes aegypti GN=AAEL008083 PE=2 SV=2 9 218 2.0E-85
sp|P38981|RSSA_URECA 40S ribosomal protein SA OS=Urechis caupo PE=2 SV=1 10 210 7.0E-85
sp|A8XSS1|RSSA_CAEBR 40S ribosomal protein SA OS=Caenorhabditis briggsae GN=rps-0 PE=3 SV=1 13 277 3.0E-84
sp|Q4Z694|RSSA_PLABA 40S ribosomal protein SA OS=Plasmodium berghei (strain Anka) GN=PB000415.00.0 PE=3 SV=1 17 229 5.0E-84
sp|Q7RBT0|RSSA_PLAYO 40S ribosomal protein SA OS=Plasmodium yoelii yoelii GN=PY06059 PE=3 SV=1 17 229 6.0E-84
sp|Q55BY1|RSSA_DICDI 40S ribosomal protein SA OS=Dictyostelium discoideum GN=rpsA PE=1 SV=1 4 218 7.0E-84
sp|A2I3Z2|RSSA_MACHI 40S ribosomal protein SA OS=Maconellicoccus hirsutus PE=2 SV=1 9 218 8.0E-84
sp|Q4XZN2|RSSA_PLACH 40S ribosomal protein SA OS=Plasmodium chabaudi GN=PC000391.02.0 PE=3 SV=1 17 229 2.0E-83
sp|B3L230|RSSA_PLAKH 40S ribosomal protein SA OS=Plasmodium knowlesi (strain H) GN=PKH_061110 PE=3 SV=1 8 233 5.0E-83
sp|B0X6V0|RSSA_CULQU 40S ribosomal protein SA OS=Culex quinquefasciatus GN=CPIJ013899 PE=3 SV=2 9 217 8.0E-83
sp|A5KE24|RSSA_PLAVS 40S ribosomal protein SA OS=Plasmodium vivax (strain Salvador I) GN=PVX_111380 PE=3 SV=1 8 229 1.0E-82
sp|Q8IJD4|RSSA_PLAF7 40S ribosomal protein SA OS=Plasmodium falciparum (isolate 3D7) GN=PF10_0264 PE=1 SV=1 17 241 3.0E-82
sp|Q4Q0Q0|RSSA_LEIMA 40S ribosomal protein SA OS=Leishmania major GN=LmjF36.5010 PE=3 SV=1 8 210 3.0E-81
sp|A4IDS4|RSSA_LEIIN 40S ribosomal protein SA OS=Leishmania infantum GN=LinJ36.5570 PE=3 SV=1 8 210 4.0E-81
sp|A4HQ28|RSSA_LEIBR 40S ribosomal protein SA OS=Leishmania braziliensis GN=LbrM35_V2.5370 PE=3 SV=1 8 210 3.0E-80
sp|A8Q2H5|RSSA_BRUMA 40S ribosomal protein SA OS=Brugia malayi GN=Bm1_41245 PE=3 SV=2 20 210 6.0E-80
sp|Q5CPC9|RSSA_CRYHO 40S ribosomal protein SA OS=Cryptosporidium hominis GN=Chro.30246 PE=3 SV=1 16 224 4.0E-78
sp|Q4U8U5|RSSA_THEAN 40S ribosomal protein SA OS=Theileria annulata GN=TA10185 PE=3 SV=1 8 271 1.0E-77
sp|Q4N1J1|RSSA_THEPA 40S ribosomal protein SA OS=Theileria parva GN=TP04_0748 PE=3 SV=1 8 271 8.0E-76
sp|Q5DA90|RSSA_SCHJA 40S ribosomal protein SA OS=Schistosoma japonicum GN=SJCHGC06078 PE=2 SV=1 10 257 4.0E-74
sp|A8BE86|RSSA_GIAIC 40S ribosomal protein SA OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=GL50803_7766 PE=3 SV=1 16 205 6.0E-66
sp|P46770|RSSA_ECHGR 40S ribosomal protein SA OS=Echinococcus granulosus GN=egmo3 PE=1 SV=1 10 244 3.0E-61
sp|P46771|RSSA_STRPU 40S ribosomal protein SA (Fragment) OS=Strongylocentrotus purpuratus PE=2 SV=1 80 210 6.0E-60
sp|A5UN64|RS2_METS3 30S ribosomal protein S2 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps2 PE=3 SV=1 16 191 2.0E-53
sp|A1RWV4|RS2_THEPD 30S ribosomal protein S2 OS=Thermofilum pendens (strain Hrk 5) GN=rps2 PE=3 SV=1 17 191 5.0E-52
sp|B7XHU4|RSSA_ENTBH 40S ribosomal protein S0 OS=Enterocytozoon bieneusi (strain H348) GN=RPS0 PE=3 SV=1 18 217 1.0E-51
sp|Q97BQ4|RS2_THEVO 30S ribosomal protein S2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps2 PE=3 SV=2 25 199 2.0E-51
sp|P57712|RS2_THEAC 30S ribosomal protein S2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps2 PE=3 SV=1 16 199 3.0E-51
sp|Q8TV23|RS2_METKA 30S ribosomal protein S2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps2 PE=3 SV=1 21 191 4.0E-51
sp|Q2NG04|RS2_METST 30S ribosomal protein S2 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rps2 PE=3 SV=1 17 202 8.0E-51
sp|Q9V191|RS2_PYRAB 30S ribosomal protein S2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps2 PE=3 SV=1 17 195 1.0E-49
sp|Q5JJD2|RS2_THEKO 30S ribosomal protein S2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps2 PE=3 SV=1 17 195 2.0E-49
sp|O59295|RS2_PYRHO 30S ribosomal protein S2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps2 PE=3 SV=2 17 195 3.0E-49
sp|A3DMR1|RS2_STAMF 30S ribosomal protein S2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rps2 PE=3 SV=1 17 191 5.0E-49
sp|Q8U0F0|RS2_PYRFU 30S ribosomal protein S2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps2 PE=1 SV=1 17 195 9.0E-49
sp|O26150|RS2_METTH 30S ribosomal protein S2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps2 PE=3 SV=1 17 202 2.0E-48
sp|Q8TT39|RS2_METAC 30S ribosomal protein S2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps2 PE=3 SV=2 17 195 1.0E-47
sp|Q8PW41|RS2_METMA 30S ribosomal protein S2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps2 PE=3 SV=1 17 195 1.0E-47
sp|P95993|RS2_SULSO 30S ribosomal protein S2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps2 PE=3 SV=1 17 191 2.0E-47
sp|Q46CL0|RS2_METBF 30S ribosomal protein S2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps2 PE=3 SV=2 17 195 4.0E-46
sp|A7IAG8|RS2_METB6 30S ribosomal protein S2 OS=Methanoregula boonei (strain 6A8) GN=rps2 PE=3 SV=1 17 189 1.0E-45
sp|Q12TI2|RS2_METBU 30S ribosomal protein S2 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rps2 PE=3 SV=1 17 197 2.0E-45
sp|A2BK84|RS2_HYPBU 30S ribosomal protein S2 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps2 PE=3 SV=1 17 191 4.0E-45
sp|A3CWI6|RS2_METMJ 30S ribosomal protein S2 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps2 PE=3 SV=1 17 190 1.0E-44
sp|Q0W8D0|RS2_METAR 30S ribosomal protein S2 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps2 PE=3 SV=1 21 189 2.0E-44
sp|P54109|RS2_METJA 30S ribosomal protein S2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps2 PE=3 SV=2 17 191 2.0E-44
sp|Q6L1Q0|RS2_PICTO 30S ribosomal protein S2 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps2 PE=3 SV=1 25 191 2.0E-44
sp|A0B6E5|RS2_METTP 30S ribosomal protein S2 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rps2 PE=3 SV=1 17 189 5.0E-44
sp|A8A8X0|RS2_IGNH4 30S ribosomal protein S2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rps2 PE=3 SV=1 17 191 4.0E-43
sp|A6UV20|RS2_META3 30S ribosomal protein S2 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rps2 PE=3 SV=1 1 191 8.0E-43
sp|A4YIM7|RS2_METS5 30S ribosomal protein S2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rps2 PE=3 SV=1 17 191 8.0E-43
sp|C4V7V1|RSSA_NOSCE 40S ribosomal protein S0 OS=Nosema ceranae (strain BRL01) GN=RPS0 PE=3 SV=1 1 218 1.0E-42
sp|A2SSV0|RS2_METLZ 30S ribosomal protein S2 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps2 PE=3 SV=1 1 191 1.0E-42
sp|O29132|RS2_ARCFU 30S ribosomal protein S2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps2 PE=1 SV=1 21 189 4.0E-42
sp|Q6LZG2|RS2_METMP 30S ribosomal protein S2 OS=Methanococcus maripaludis (strain S2 / LL) GN=rps2 PE=3 SV=1 17 191 6.0E-42
sp|A6USE6|RS2_METVS 30S ribosomal protein S2 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rps2 PE=3 SV=1 17 191 7.0E-42
sp|A6VJX3|RS2_METM7 30S ribosomal protein S2 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rps2 PE=3 SV=1 1 191 8.0E-42
sp|A9A7B6|RS2_METM6 30S ribosomal protein S2 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rps2 PE=3 SV=1 1 191 8.0E-42
sp|P39478|RS2_SULAC 30S ribosomal protein S2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps2 PE=3 SV=2 17 191 8.0E-42
sp|A4FYC9|RS2_METM5 30S ribosomal protein S2 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rps2 PE=3 SV=1 17 191 2.0E-41
sp|Q96YW5|RS2_SULTO 30S ribosomal protein S2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps2 PE=3 SV=1 17 191 3.0E-41
sp|Q2FTN4|RS2_METHJ 30S ribosomal protein S2 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps2 PE=3 SV=1 10 193 2.0E-40
sp|Q18G63|RS2_HALWD 30S ribosomal protein S2 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rps2 PE=3 SV=1 17 189 3.0E-40
sp|A4WH11|RS2_PYRAR 30S ribosomal protein S2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps2 PE=3 SV=1 17 191 4.0E-40
sp|P57713|RS2_HALSA 30S ribosomal protein S2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps2 PE=3 SV=1 17 189 6.0E-40
sp|B0R4Y9|RS2_HALS3 30S ribosomal protein S2 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rps2 PE=3 SV=1 17 189 6.0E-40
sp|Q8SS60|RSSA_ENCCU 40S ribosomal protein S0 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPS0 PE=1 SV=1 17 209 8.0E-40
sp|P29202|RS2_HALMA 30S ribosomal protein S2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps2 PE=1 SV=2 17 189 9.0E-40
sp|Q8ZYE2|RS2_PYRAE 30S ribosomal protein S2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps2 PE=3 SV=1 17 191 1.0E-39
sp|Q3IQS9|RS2_NATPD 30S ribosomal protein S2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rps2 PE=3 SV=1 17 189 2.0E-39
sp|A1RTJ3|RS2_PYRIL 30S ribosomal protein S2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps2 PE=3 SV=1 17 191 3.0E-39
sp|A3MS50|RS2_PYRCJ 30S ribosomal protein S2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps2 PE=3 SV=1 17 191 7.0E-39
sp|B1YA42|RS2_PYRNV 30S ribosomal protein S2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rps2 PE=3 SV=1 17 191 9.0E-39
sp|B1L5N1|RS2_KORCO 30S ribosomal protein S2 OS=Korarchaeum cryptofilum (strain OPF8) GN=rps2 PE=3 SV=1 21 191 1.0E-36
sp|A8MC33|RS2_CALMQ 30S ribosomal protein S2 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rps2 PE=3 SV=1 39 191 1.0E-36
sp|Q9YB45|RS2_AERPE 30S ribosomal protein S2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps2 PE=3 SV=1 35 191 3.0E-36
sp|Q74M65|RS2_NANEQ 30S ribosomal protein S2 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rps2 PE=3 SV=1 17 191 2.0E-34
sp|A9A428|RS2_NITMS 30S ribosomal protein S2 OS=Nitrosopumilus maritimus (strain SCM1) GN=rps2 PE=3 SV=1 35 191 3.0E-32
sp|A0RY14|RS2_CENSY 30S ribosomal protein S2 OS=Cenarchaeum symbiosum (strain A) GN=rps2 PE=3 SV=1 36 191 5.0E-28
sp|Q03FT6|RS2_PEDPA 30S ribosomal protein S2 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpsB PE=3 SV=1 17 188 1.0E-09
sp|B9EBD6|RS2_MACCJ 30S ribosomal protein S2 OS=Macrococcus caseolyticus (strain JCSC5402) GN=rpsB PE=3 SV=1 17 216 1.0E-09
sp|B5ZAJ9|RS2_UREU1 30S ribosomal protein S2 OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=rpsB PE=3 SV=1 119 203 2.0E-09
sp|Q1AW68|RS2_RUBXD 30S ribosomal protein S2 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rpsB PE=3 SV=1 17 189 2.0E-09
sp|Q2SSA8|RS2_MYCCT 30S ribosomal protein S2 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rpsB PE=3 SV=1 114 181 5.0E-09
sp|P66545|RS2_STAAW 30S ribosomal protein S2 OS=Staphylococcus aureus (strain MW2) GN=rpsB PE=3 SV=1 17 219 6.0E-09
sp|A8Z3T6|RS2_STAAT 30S ribosomal protein S2 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rpsB PE=3 SV=1 17 219 6.0E-09
sp|Q6G9V7|RS2_STAAS 30S ribosomal protein S2 OS=Staphylococcus aureus (strain MSSA476) GN=rpsB PE=3 SV=1 17 219 6.0E-09
sp|Q6GHH9|RS2_STAAR 30S ribosomal protein S2 OS=Staphylococcus aureus (strain MRSA252) GN=rpsB PE=3 SV=1 17 219 6.0E-09
sp|P66544|RS2_STAAN 30S ribosomal protein S2 OS=Staphylococcus aureus (strain N315) GN=rpsB PE=1 SV=1 17 219 6.0E-09
sp|P66543|RS2_STAAM 30S ribosomal protein S2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpsB PE=3 SV=1 17 219 6.0E-09
sp|A6QGF6|RS2_STAAE 30S ribosomal protein S2 OS=Staphylococcus aureus (strain Newman) GN=rpsB PE=3 SV=1 17 219 6.0E-09
sp|Q2YXL2|RS2_STAAB 30S ribosomal protein S2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpsB PE=3 SV=1 17 219 6.0E-09
sp|Q2FZ25|RS2_STAA8 30S ribosomal protein S2 OS=Staphylococcus aureus (strain NCTC 8325) GN=rpsB PE=3 SV=2 17 219 6.0E-09
sp|Q2FHI2|RS2_STAA3 30S ribosomal protein S2 OS=Staphylococcus aureus (strain USA300) GN=rpsB PE=3 SV=1 17 219 6.0E-09
sp|A7X1N3|RS2_STAA1 30S ribosomal protein S2 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rpsB PE=3 SV=1 17 219 6.0E-09
sp|Q9PRB9|RS2_UREPA 30S ribosomal protein S2 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rpsB PE=3 SV=1 119 203 7.0E-09
sp|B1AI12|RS2_UREP2 30S ribosomal protein S2 OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=rpsB PE=3 SV=1 119 203 7.0E-09
sp|P49668|RS2_PEDAC 30S ribosomal protein S2 OS=Pediococcus acidilactici GN=rpsB PE=3 SV=1 17 188 7.0E-09
sp|A5ISE0|RS2_STAA9 30S ribosomal protein S2 OS=Staphylococcus aureus (strain JH9) GN=rpsB PE=3 SV=1 17 219 9.0E-09
sp|A6U174|RS2_STAA2 30S ribosomal protein S2 OS=Staphylococcus aureus (strain JH1) GN=rpsB PE=3 SV=1 17 219 9.0E-09
sp|Q8EUG1|RS2_MYCPE 30S ribosomal protein S2 OS=Mycoplasma penetrans (strain HF-2) GN=rpsB PE=3 SV=1 116 189 1.0E-08
sp|Q88VJ4|RS2_LACPL 30S ribosomal protein S2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpsB PE=3 SV=1 17 188 2.0E-08
sp|Q5HGH6|RS2_STAAC 30S ribosomal protein S2 OS=Staphylococcus aureus (strain COL) GN=rpsB PE=3 SV=1 17 204 2.0E-08
sp|P80371|RS2_THET8 30S ribosomal protein S2 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpsB PE=1 SV=4 17 217 3.0E-08
sp|P62662|RS2_THET2 30S ribosomal protein S2 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpsB PE=1 SV=2 17 217 3.0E-08
sp|Q4L5V8|RS2_STAHJ 30S ribosomal protein S2 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpsB PE=3 SV=1 17 197 4.0E-08
sp|A7HMF2|RS2_FERNB 30S ribosomal protein S2 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rpsB PE=3 SV=1 17 197 5.0E-08
sp|B1MZ65|RS2_LEUCK 30S ribosomal protein S2 OS=Leuconostoc citreum (strain KM20) GN=rpsB PE=3 SV=2 20 188 6.0E-08
sp|P75560|RS2_MYCPN 30S ribosomal protein S2 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rpsB PE=3 SV=1 115 230 7.0E-08
sp|Q1WUL5|RS2_LACS1 30S ribosomal protein S2 OS=Lactobacillus salivarius (strain UCC118) GN=rpsB PE=3 SV=1 17 188 9.0E-08
sp|Q8CSU2|RS2_STAES 30S ribosomal protein S2 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpsB PE=3 SV=1 17 197 1.0E-07
sp|Q5HPT5|RS2_STAEQ 30S ribosomal protein S2 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpsB PE=3 SV=1 17 197 1.0E-07
sp|Q03WX5|RS2_LEUMM 30S ribosomal protein S2 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpsB PE=3 SV=1 20 188 1.0E-07
sp|Q38W64|RS2_LACSS 30S ribosomal protein S2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpsB PE=3 SV=1 121 188 1.0E-07
sp|P47316|RS2_MYCGE 30S ribosomal protein S2 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rpsB PE=3 SV=1 121 203 1.0E-07
sp|Q04F88|RS2_OENOB 30S ribosomal protein S2 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpsB PE=3 SV=1 121 188 2.0E-07
sp|Q49X41|RS2_STAS1 30S ribosomal protein S2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpsB PE=3 SV=1 17 204 2.0E-07
sp|B9DPG8|RS2_STACT 30S ribosomal protein S2 OS=Staphylococcus carnosus (strain TM300) GN=rpsB PE=3 SV=1 17 204 2.0E-07
sp|A9NHC6|RS2_ACHLI 30S ribosomal protein S2 OS=Acholeplasma laidlawii (strain PG-8A) GN=rpsB PE=3 SV=1 17 194 3.0E-07
sp|Q6F0Q4|RS2_MESFL 30S ribosomal protein S2 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpsB PE=3 SV=2 35 176 7.0E-07
sp|B8FGE6|RS2_DESAA 30S ribosomal protein S2 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=rpsB PE=3 SV=1 20 182 3.0E-06
sp|Q98Q36|RS2_MYCPU 30S ribosomal protein S2 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rpsB PE=3 SV=1 120 209 3.0E-06
sp|Q6MGY6|RS2_BDEBA 30S ribosomal protein S2 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rpsB PE=3 SV=1 20 227 5.0E-06
sp|Q1IZI6|RS2_DEIGD 30S ribosomal protein S2 OS=Deinococcus geothermalis (strain DSM 11300) GN=rpsB PE=3 SV=1 110 189 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:0043043 peptide biosynthetic process No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0006518 peptide metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0005198 structural molecule activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043228 non-membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0043603 cellular amide metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3742
MAPSNLPSVLNATSRDIEMLLAAQCHQGNKNLQVHMEPYLWKTRADGVNIINIGKTWEKIVLAARIIVAVDNPAD
ICVISARPYGQRAVLKFAAHTGASSIAGRFTPGSFTNYITRSFKEPRLIVVTDPRTDAQAIKEASYVNIPVIALC
DTDSPTEYVDVAIPTNNKGRNAIGTIWWLLAREVLRLRGTIYNRETAWDVMPDLYFYRDPEAEAEEEKAGGGEEE
APAAVETTTAAATAGDWEAPTAGFTGATGTGWDGAEGATGGGDWAASGGNTEWAAEATKESSTHW*
Coding >Ophun1|3742
ATGGCCCCCTCAAACTTGCCTTCGGTGCTCAATGCCACCAGCCGGGACATTGAGATGCTCCTGGCTGCTCAGTGC
CACCAGGGAAACAAGAATCTTCAGGTTCACATGGAGCCGTATTTGTGGAAGACGCGCGCCGACGGTGTCAACATT
ATCAACATCGGCAAGACCTGGGAGAAGATTGTTCTGGCTGCGCGCATCATCGTCGCCGTCGACAACCCCGCCGAC
ATTTGCGTCATCTCGGCTCGTCCCTACGGTCAGCGCGCCGTGCTCAAGTTCGCAGCCCACACGGGCGCCTCTTCG
ATTGCCGGCCGCTTCACCCCCGGAAGCTTCACCAACTACATCACCCGCTCGTTCAAGGAGCCGCGTCTGATTGTG
GTGACGGATCCTCGCACCGACGCCCAAGCCATCAAGGAGGCCAGCTACGTCAACATCCCCGTCATTGCCCTCTGC
GACACCGACTCGCCCACCGAGTACGTCGACGTTGCCATTCCCACCAACAACAAGGGTCGCAACGCCATCGGTACC
ATCTGGTGGTTGCTTGCCCGTGAGGTCCTCCGCCTCCGCGGCACCATCTACAACCGCGAGACGGCCTGGGACGTG
ATGCCCGATCTGTACTTCTACCGCGACCCCGAGGCCGAGGCCGAGGAAGAAAAGGCCGGCGGTGGCGAGGAGGAA
GCTCCTGCTGCTGTGGAGACGACGACGGCTGCAGCGACGGCAGGCGACTGGGAGGCGCCCACCGCCGGCTTCACG
GGCGCGACGGGCACCGGATGGGACGGAGCCGAGGGCGCGACGGGCGGCGGCGACTGGGCCGCGTCGGGAGGCAAC
ACGGAATGGGCCGCCGAAGCCACCAAGGAGTCGTCCACGCACTGGTAG
Transcript >Ophun1|3742
ATGGCCCCCTCAAACTTGCCTTCGGTGCTCAATGCCACCAGCCGGGACATTGAGATGCTCCTGGCTGCTCAGTGC
CACCAGGGAAACAAGAATCTTCAGGTTCACATGGAGCCGTATTTGTGGAAGACGCGCGCCGACGGTGTCAACATT
ATCAACATCGGCAAGACCTGGGAGAAGATTGTTCTGGCTGCGCGCATCATCGTCGCCGTCGACAACCCCGCCGAC
ATTTGCGTCATCTCGGCTCGTCCCTACGGTCAGCGCGCCGTGCTCAAGTTCGCAGCCCACACGGGCGCCTCTTCG
ATTGCCGGCCGCTTCACCCCCGGAAGCTTCACCAACTACATCACCCGCTCGTTCAAGGAGCCGCGTCTGATTGTG
GTGACGGATCCTCGCACCGACGCCCAAGCCATCAAGGAGGCCAGCTACGTCAACATCCCCGTCATTGCCCTCTGC
GACACCGACTCGCCCACCGAGTACGTCGACGTTGCCATTCCCACCAACAACAAGGGTCGCAACGCCATCGGTACC
ATCTGGTGGTTGCTTGCCCGTGAGGTCCTCCGCCTCCGCGGCACCATCTACAACCGCGAGACGGCCTGGGACGTG
ATGCCCGATCTGTACTTCTACCGCGACCCCGAGGCCGAGGCCGAGGAAGAAAAGGCCGGCGGTGGCGAGGAGGAA
GCTCCTGCTGCTGTGGAGACGACGACGGCTGCAGCGACGGCAGGCGACTGGGAGGCGCCCACCGCCGGCTTCACG
GGCGCGACGGGCACCGGATGGGACGGAGCCGAGGGCGCGACGGGCGGCGGCGACTGGGCCGCGTCGGGAGGCAAC
ACGGAATGGGCCGCCGAAGCCACCAAGGAGTCGTCCACGCACTGGTAG
Gene >Ophun1|3742
ATGGCCCCCTCAAACTTGCCTTCGGTGCTCAATGCCACCAGCCGGGACATTGAGATGCTCCTGGCTGCTCAGTGC
CACCAGGGAAACAAGAATCTTCAGGTTCACATGGAGCCGTATTTGTGGAAGACGCGCGCCGACGGTGTCAACATT
ATCAACATCGGCAAGACCTGGTCAGCACTCCTCGGCAGGATAGAAAAACCTCACGCTCACACCGTAACAGGGAGA
AGATTGTTCTGGCTGCGCGCATCATCGTCGCCGTCGACAACCCCGCCGACATTTGCGTCATCTCGGCTCGTCCCT
ACGGTCAGCGCGCCGTGCTCAAGTTCGCAGCCCACACGGGCGCCTCTTCGATTGCCGGCCGCTTCACCCCCGGAA
GCTTCACCAACTACATCACCCGCTCGTTCAAGGAGCCGCGTCTGATTGTGGTGACGGATCCTCGCACCGACGCCC
AAGCCATCAAGGAGGCCAGCTACGTCAACATCCCCGTCATTGCCCTCTGCGACACCGACTCGCCCACCGAGTACG
TCGACGTTGCCATTCCCACCAACAACAAGGGTCGCAACGCCATCGGTACCATCTGGTGGTTGCTTGCCCGTGAGG
TCCTCCGCCTCCGCGGCACCATCTACAACCGCGAGACGGCCTGGGACGTGATGCCCGATCTGTACTTCTGTGAGT
CGACTATTCTGTCGTTGCCGGGCCTGTGCTGACTCTGTTCCAACAGACCGCGACCCCGAGGCCGAGGCCGAGGAA
GAAAAGGCCGGCGGTGGCGAGGAGGAAGCTCCTGCTGCTGTGGAGACGACGACGGCTGCAGCGACGGCAGGCGAC
TGGGAGGCGCCCACCGCCGGCTTCACGGGCGCGACGGGCACCGGATGGGACGGAGCCGAGGGCGCGACGGGCGGC
GGCGACTGGGCCGCGTCGGGAGGCAACACGGAATGGGCCGCCGAAGCCACCAAGGAGTCGTCCACGCACTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail