Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|374
Gene name
LocationContig_11:72041..73436
Strand+
Gene length (bp)1395
Transcript length (bp)948
Coding sequence length (bp)948
Protein length (aa) 316

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01541 GIY-YIG GIY-YIG catalytic domain 2.7E-13 13 88

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B2B674|SLX1_PODAN Structure-specific endonuclease subunit SLX1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=SLX1 PE=3 SV=1 7 292 2.0E-93
sp|Q2GWJ7|SLX1_CHAGB Structure-specific endonuclease subunit SLX1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SLX1 PE=3 SV=1 8 292 2.0E-92
sp|Q9P737|SLX1_NEUCR Structure-specific endonuclease subunit slx1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=slx1 PE=3 SV=1 7 279 5.0E-85
sp|A6RYJ8|SLX1_BOTFB Structure-specific endonuclease subunit slx1 OS=Botryotinia fuckeliana (strain B05.10) GN=slx1 PE=3 SV=2 5 295 1.0E-70
sp|B2WM34|SLX1_PYRTR Structure-specific endonuclease subunit slx1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=slx1 PE=3 SV=1 7 285 8.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B2B674|SLX1_PODAN Structure-specific endonuclease subunit SLX1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=SLX1 PE=3 SV=1 7 292 2.0E-93
sp|Q2GWJ7|SLX1_CHAGB Structure-specific endonuclease subunit SLX1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SLX1 PE=3 SV=1 8 292 2.0E-92
sp|Q9P737|SLX1_NEUCR Structure-specific endonuclease subunit slx1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=slx1 PE=3 SV=1 7 279 5.0E-85
sp|A6RYJ8|SLX1_BOTFB Structure-specific endonuclease subunit slx1 OS=Botryotinia fuckeliana (strain B05.10) GN=slx1 PE=3 SV=2 5 295 1.0E-70
sp|B2WM34|SLX1_PYRTR Structure-specific endonuclease subunit slx1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=slx1 PE=3 SV=1 7 285 8.0E-60
sp|Q0UAL6|SLX1_PHANO Structure-specific endonuclease subunit SLX1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SLX1 PE=3 SV=3 7 291 6.0E-59
sp|C1GJU5|SLX1_PARBD Structure-specific endonuclease subunit SLX1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=SLX1 PE=3 SV=2 7 292 4.0E-50
sp|C1H0K4|SLX1_PARBA Structure-specific endonuclease subunit SLX1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=SLX1 PE=3 SV=3 7 292 5.0E-49
sp|A1C4Z4|SLX1_ASPCL Structure-specific endonuclease subunit slx1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=slx1 PE=3 SV=1 7 306 5.0E-47
sp|C0S8C7|SLX1_PARBP Structure-specific endonuclease subunit SLX1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=SLX1 PE=3 SV=1 7 292 1.0E-45
sp|Q4WEL6|SLX1_ASPFU Structure-specific endonuclease subunit slx1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=slx1 PE=3 SV=1 7 279 3.0E-45
sp|B0Y2U0|SLX1_ASPFC Structure-specific endonuclease subunit slx1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=slx1 PE=3 SV=1 7 279 3.0E-45
sp|Q0CE14|SLX1_ASPTN Structure-specific endonuclease subunit slx1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=slx1 PE=3 SV=1 7 292 1.0E-43
sp|C0NTM8|SLX1_AJECG Structure-specific endonuclease subunit SLX1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=SLX1 PE=3 SV=1 8 299 2.0E-43
sp|B6HK90|SLX1_PENRW Structure-specific endonuclease subunit slx1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=slx1 PE=3 SV=1 7 291 1.0E-42
sp|A2QUJ2|SLX1_ASPNC Structure-specific endonuclease subunit slx1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=slx1 PE=3 SV=1 7 291 2.0E-42
sp|B8MDD1|SLX1_TALSN Structure-specific endonuclease subunit slx1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=slx1 PE=3 SV=1 2 299 4.0E-41
sp|A1CZX3|SLX1_NEOFI Structure-specific endonuclease subunit slx1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=slx1 PE=3 SV=1 7 291 8.0E-40
sp|B6QFH5|SLX1_TALMQ Structure-specific endonuclease subunit slx1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=slx1 PE=3 SV=1 7 299 7.0E-38
sp|Q5AU18|SLX1_EMENI Structure-specific endonuclease subunit slx1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=slx1 PE=3 SV=1 20 292 2.0E-36
sp|Q2UA42|SLX1_ASPOR Structure-specific endonuclease subunit slx1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=slx1 PE=3 SV=1 1 292 3.0E-35
sp|Q6BWW4|SLX1_DEBHA Structure-specific endonuclease subunit SLX1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SLX1 PE=3 SV=2 10 287 1.0E-34
sp|Q6C0W7|SLX1_YARLI Structure-specific endonuclease subunit SLX1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SLX1 PE=3 SV=1 10 263 2.0E-31
sp|Q6FML9|SLX1_CANGA Structure-specific endonuclease subunit SLX1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SLX1 PE=1 SV=1 7 301 3.0E-29
sp|Q75EA5|SLX1_ASHGO Structure-specific endonuclease subunit SLX1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SLX1 PE=3 SV=1 9 157 8.0E-28
sp|A7TTE6|SLX1_VANPO Structure-specific endonuclease subunit SLX1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SLX1 PE=3 SV=1 9 300 5.0E-26
sp|B9WGW9|SLX1_CANDC Structure-specific endonuclease subunit SLX1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=SLX1 PE=3 SV=1 9 157 7.0E-26
sp|Q6CKL8|SLX1_KLULA Structure-specific endonuclease subunit SLX1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SLX1 PE=3 SV=1 9 276 4.0E-25
sp|P38324|SLX1_YEAST Structure-specific endonuclease subunit SLX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLX1 PE=1 SV=1 9 291 6.0E-25
sp|A3LZG5|SLX1_PICST Structure-specific endonuclease subunit SLX1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SLX1 PE=3 SV=2 9 179 7.0E-25
sp|P0CN80|SLX1_CRYNJ Structure-specific endonuclease subunit SLX1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SLX1 PE=3 SV=1 9 280 8.0E-25
sp|P0CN81|SLX1_CRYNB Structure-specific endonuclease subunit SLX1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SLX1 PE=3 SV=1 9 280 8.0E-25
sp|B3LMT5|SLX1_YEAS1 Structure-specific endonuclease subunit SLX1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SLX1 PE=3 SV=1 9 287 2.0E-24
sp|B5VEH8|SLX1_YEAS6 Structure-specific endonuclease subunit SLX1 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SLX1 PE=3 SV=1 9 287 2.0E-24
sp|A6ZLG6|SLX1_YEAS7 Structure-specific endonuclease subunit SLX1 OS=Saccharomyces cerevisiae (strain YJM789) GN=SLX1 PE=3 SV=1 9 287 2.0E-24
sp|Q4PDF6|SLX1_USTMA Structure-specific endonuclease subunit SLX1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SLX1 PE=3 SV=1 9 159 1.0E-23
sp|A5DFX7|SLX1_PICGU Structure-specific endonuclease subunit SLX1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SLX1 PE=3 SV=2 10 92 9.0E-23
sp|B6JY16|SLX1_SCHJY Structure-specific endonuclease subunit slx1 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=slx1 PE=3 SV=1 12 159 9.0E-22
sp|Q9P7M3|SLX1_SCHPO Structure-specific endonuclease subunit slx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slx1 PE=1 SV=1 9 159 3.0E-20
sp|A8PWH1|SLX1_MALGO Structure-specific endonuclease subunit SLX1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=SLX1 PE=3 SV=1 1 158 6.0E-19
sp|Q0IH86|SLX1_XENLA Structure-specific endonuclease subunit slx1 OS=Xenopus laevis GN=slx1a PE=2 SV=1 9 97 9.0E-17
sp|A4I1H7|SLX1_LEIIN Structure-specific endonuclease subunit SLX1 homolog OS=Leishmania infantum GN=LinJ25.1380 PE=3 SV=1 12 149 6.0E-16
sp|A7STV9|SLX1_NEMVE Structure-specific endonuclease subunit SLX1 homolog OS=Nematostella vectensis GN=v1g174298 PE=3 SV=1 11 152 1.0E-15
sp|Q9BQ83|SLX1_HUMAN Structure-specific endonuclease subunit SLX1 OS=Homo sapiens GN=SLX1A PE=1 SV=1 3 89 1.0E-14
sp|Q4CTY5|SLX12_TRYCC Structure-specific endonuclease subunit SLX1 homolog 2 OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053511881.30 PE=3 SV=1 12 152 1.0E-14
sp|B3M0F3|SLX1_DROAN Structure-specific endonuclease subunit SLX1 homolog OS=Drosophila ananassae GN=slx1 PE=3 SV=1 12 92 2.0E-14
sp|B4GEU1|SLX1_DROPE Structure-specific endonuclease subunit SLX1 homolog OS=Drosophila persimilis GN=slx1 PE=3 SV=1 12 92 2.0E-14
sp|Q4D7L5|SLX11_TRYCC Structure-specific endonuclease subunit SLX1 homolog 1 OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053509453.60 PE=3 SV=1 12 149 2.0E-14
sp|B5DXG8|SLX1_DROPS Structure-specific endonuclease subunit SLX1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=slx1 PE=3 SV=1 12 92 2.0E-14
sp|Q5CT62|SLX1_CRYPI Structure-specific endonuclease subunit SLX1 homolog OS=Cryptosporidium parvum (strain Iowa II) GN=cgd2_4280 PE=3 SV=1 12 236 2.0E-14
sp|Q32PI0|SLX1_BOVIN Structure-specific endonuclease subunit SLX1 OS=Bos taurus GN=SLX1A PE=2 SV=1 11 89 3.0E-14
sp|B4KBJ0|SLX1_DROMO Structure-specific endonuclease subunit SLX1 homolog OS=Drosophila mojavensis GN=slx1 PE=3 SV=1 12 89 4.0E-14
sp|B4JGW7|SLX1_DROGR Structure-specific endonuclease subunit SLX1 homolog OS=Drosophila grimshawi GN=slx1 PE=3 SV=1 12 92 5.0E-14
sp|Q5TXB2|SLX1_ANOGA Structure-specific endonuclease subunit SLX1 homolog OS=Anopheles gambiae GN=AGAP002259 PE=3 SV=3 9 158 1.0E-13
sp|Q8BX32|SLX1_MOUSE Structure-specific endonuclease subunit SLX1 OS=Mus musculus GN=Slx1b PE=2 SV=1 12 89 2.0E-13
sp|A8WJ66|SLX1_CAEBR Structure-specific endonuclease subunit SLX1 homolog OS=Caenorhabditis briggsae GN=giyd-1 PE=3 SV=2 12 98 2.0E-13
sp|Q5PQP5|SLX1_RAT Structure-specific endonuclease subunit SLX1 OS=Rattus norvegicus GN=Slx1b PE=2 SV=1 12 89 3.0E-13
sp|P91351|SLX1_CAEEL Structure-specific endonuclease subunit SLX1 homolog OS=Caenorhabditis elegans GN=slx-1 PE=1 SV=1 12 98 8.0E-13
sp|Q57XV5|SLX1_TRYB2 Structure-specific endonuclease subunit SLX1 homolog OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb927.3.1220 PE=3 SV=1 12 154 9.0E-13
sp|Q9VN41|SLX1_DROME Structure-specific endonuclease subunit SLX1 homolog OS=Drosophila melanogaster GN=slx1 PE=1 SV=3 12 185 1.0E-12
sp|A8PV03|SLX1_BRUMA Structure-specific endonuclease subunit SLX1 homolog OS=Brugia malayi GN=Bm1_35165 PE=3 SV=1 9 89 2.0E-12
sp|B4I3R2|SLX1_DROSE Structure-specific endonuclease subunit SLX1 homolog OS=Drosophila sechellia GN=slx1 PE=3 SV=2 12 92 3.0E-12
sp|B3P230|SLX1_DROER Structure-specific endonuclease subunit SLX1 homolog OS=Drosophila erecta GN=slx1 PE=3 SV=2 12 92 3.0E-12
sp|A8B2Z8|SLX1_GIAIC Structure-specific endonuclease subunit SLX1 homolog OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=GL50803_16475 PE=3 SV=1 12 92 1.0E-11
sp|A9V196|SLX1_MONBE Structure-specific endonuclease subunit SLX1 homolog OS=Monosiga brevicollis GN=8836 PE=3 SV=1 29 159 2.0E-11
sp|Q4Q9W0|SLX1_LEIMA Structure-specific endonuclease subunit SLX1 homolog OS=Leishmania major GN=LmjF25.1330 PE=3 SV=1 12 165 3.0E-10
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4492
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3170
Ophiocordyceps australis map64 (Brazil) OphauB2|1734
Ophiocordyceps camponoti-floridani Ophcf2|05290
Ophiocordyceps camponoti-rufipedis Ophun1|374 (this protein)
Ophiocordyceps kimflemingae Ophio5|8284
Ophiocordyceps subramaniannii Hirsu2|9371

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|374
MKGVICRPLPALYTVYVLRSSVRKSSLYIGSTPNPRRRLKQHNGDTKGGAMRTSRHSLRPWEMVALVSGFPSMIA
ALKFEWALTNPHLSLHIPKESRLTVAKSPGKARRGRKRRRPRRPPHSLLSVVSNLHLLTGVPSFARWPLDLHFFA
REVYAAWEKWVAKSKSKARSTKSKSKPSISRSRSRSRSPKPAPPCRAGMRIWTDFAEDAEPDEPTGVHALPIDYK
PMKDYLQKARDVVGFEREGACVHCGEELESGRGLHAMCPLDGCTAMGHLDCWSRHGLAGDDEGHMLPDLLHGPAA
PAGAAANISPGLGVA*
Coding >Ophun1|374
ATGAAGGGCGTGATATGTCGGCCCCTTCCGGCGCTGTACACGGTCTACGTCCTGCGATCAAGCGTACGAAAGTCT
TCTCTTTACATCGGCTCGACTCCGAACCCGCGGCGGCGCCTGAAGCAGCACAATGGCGACACCAAGGGGGGAGCG
ATGCGAACATCGCGACACAGCCTGCGGCCGTGGGAGATGGTGGCGCTGGTGTCTGGGTTCCCGAGCATGATTGCA
GCGCTTAAGTTTGAGTGGGCGCTTACGAACCCGCATCTCTCGTTGCATATCCCCAAGGAGTCCCGGTTGACGGTG
GCCAAGTCGCCGGGCAAGGCGAGGAGGGGCAGAAAGAGGAGGAGACCGCGAAGGCCGCCACATAGCCTGCTCTCA
GTCGTGTCCAACTTGCATCTCCTCACTGGGGTACCGAGCTTCGCGAGATGGCCGCTAGACTTGCACTTTTTCGCG
CGCGAAGTGTACGCTGCTTGGGAGAAGTGGGTGGCGAAATCCAAGTCCAAAGCACGCTCAACCAAGTCCAAGTCC
AAGCCCTCGATATCCAGATCGAGGTCAAGATCCCGGTCGCCGAAGCCAGCGCCGCCGTGCCGAGCCGGGATGCGC
ATCTGGACGGACTTTGCCGAAGACGCAGAGCCAGACGAGCCGACGGGCGTGCATGCGTTACCGATCGATTACAAG
CCTATGAAGGACTACCTGCAGAAGGCGCGAGACGTGGTGGGCTTCGAGCGTGAAGGCGCGTGCGTGCACTGCGGG
GAGGAGCTCGAGTCCGGACGCGGGTTGCATGCCATGTGTCCGCTCGACGGCTGCACCGCCATGGGGCATCTCGAC
TGCTGGAGTCGGCACGGGCTGGCGGGAGACGACGAGGGACATATGCTGCCCGACTTGCTGCACGGACCAGCTGCC
CCTGCGGGAGCGGCGGCCAATATCAGTCCAGGCCTTGGCGTGGCATGA
Transcript >Ophun1|374
ATGAAGGGCGTGATATGTCGGCCCCTTCCGGCGCTGTACACGGTCTACGTCCTGCGATCAAGCGTACGAAAGTCT
TCTCTTTACATCGGCTCGACTCCGAACCCGCGGCGGCGCCTGAAGCAGCACAATGGCGACACCAAGGGGGGAGCG
ATGCGAACATCGCGACACAGCCTGCGGCCGTGGGAGATGGTGGCGCTGGTGTCTGGGTTCCCGAGCATGATTGCA
GCGCTTAAGTTTGAGTGGGCGCTTACGAACCCGCATCTCTCGTTGCATATCCCCAAGGAGTCCCGGTTGACGGTG
GCCAAGTCGCCGGGCAAGGCGAGGAGGGGCAGAAAGAGGAGGAGACCGCGAAGGCCGCCACATAGCCTGCTCTCA
GTCGTGTCCAACTTGCATCTCCTCACTGGGGTACCGAGCTTCGCGAGATGGCCGCTAGACTTGCACTTTTTCGCG
CGCGAAGTGTACGCTGCTTGGGAGAAGTGGGTGGCGAAATCCAAGTCCAAAGCACGCTCAACCAAGTCCAAGTCC
AAGCCCTCGATATCCAGATCGAGGTCAAGATCCCGGTCGCCGAAGCCAGCGCCGCCGTGCCGAGCCGGGATGCGC
ATCTGGACGGACTTTGCCGAAGACGCAGAGCCAGACGAGCCGACGGGCGTGCATGCGTTACCGATCGATTACAAG
CCTATGAAGGACTACCTGCAGAAGGCGCGAGACGTGGTGGGCTTCGAGCGTGAAGGCGCGTGCGTGCACTGCGGG
GAGGAGCTCGAGTCCGGACGCGGGTTGCATGCCATGTGTCCGCTCGACGGCTGCACCGCCATGGGGCATCTCGAC
TGCTGGAGTCGGCACGGGCTGGCGGGAGACGACGAGGGACATATGCTGCCCGACTTGCTGCACGGACCAGCTGCC
CCTGCGGGAGCGGCGGCCAATATCAGTCCAGGCCTTGGCGTGGCATGA
Gene >Ophun1|374
ATGAAGGGCGTGATATGTCGGCCCCTTCCGGCGCTGTACACGGTCTACGTCCTGCGATCAAGCGTACGAAAGTCT
TCTCTTTACATCGGCTCGACTCCGAACCCGCGGCGGCGCCTGAAGCAGCACAATGGCGACACCAAGGGGGGAGCG
ATGCGAACATCGCGACACAGCCTGCGGCCGTGGGAGATGGTGGCGCTGGTGTCTGGGTTCCCGAGCATGATTGCA
GCGCTTAAGTTTGAGTGAGTGCGTGATTCAAAGACTATCAGGATCCGAGTCGCTGATGAGATGAAACCAGGTGGG
CGCTTACGAACCCGCATCTCTCGTTGCATATCCCCAAGGAGTCCCGGTTGACGGTGGCCAAGTCGCCGGGCAAGG
CGAGGAGGGGCAGAAAGAGGAGGAGACCGCGAAGGCCGCCACATAGCCTGCTCTCAGTCGTGTCCAACTTGCATC
TCCTCACTGGGGTACCGAGCTTCGCGAGATGGCCGCTAGACTTGCACTTTTTCGCGCGCGAAGTGTACGCTGCTT
GGGAGAAGTGGGTGGCGAAATCCAAGTCCAAAGCACGCTCAACCAAGTCCAAGTCCAAGCCCTCGATATCCAGAT
CGAGGTCAAGATCCCGGTCGCCGAAGCCAGCGCCGCCGTGCCGAGCCGGGATGCGCATCTGGACGGACTTTGCCG
AAGACGCAGAGCCAGACGAGCCGACGGGCGTGCATGCGTTACCGATCGATTACAAGCCTATGAAGGACTACCTGC
AGAAGGCGCGAGACGTGGTGGGCTTCGAGCGTGAAGGCGCGTGCGTGCACTGCGGGGAGGAGCTCGAGTCCGGAC
GCGGGTTGCATGCCATGTGTCCGCTCGACGGCTGCACCGCCATGGGGCATCTCGACTGCTGGAGTCGGCACGGGC
TGGCGGGAGACGACGAGGGACATATGCTGCCCGACTTGCTGCAGTGCGTAAGCTGCGGGGGACAGGCGAGATGGA
GTGACATGATTCGAGAGCTGAGCCTGCGCATACGAGGGGAGAAGGAGGTGGAGCGGCTGTTGAAGAAGAAGAAGG
CGAAGAAGAAAGGGAGGAAGAAGACGGCTAAGAAAAGGGGGAAAGAGGAGGAGGAGGAGGAAGCGGAAGAGGAGG
AGGATGAAGACAATATCTCTCAGGAAAACGATGATAGCGGAAGCGATAGTTTACAGAGTCATTGACCCTGGCGGG
CGTCGTCAAAGAGGCTACTCACGATTCTAGATCCTCCCTTGCCATGCACGTCGTCAACTCAGAGCCGGGGTGCCC
CGCTTGACTGGGGCGGAAAAGCGACTTCATCGGCCGCTGATTGGCTGGACGCGTCCCAGCGGACCAGCTGCCCCT
GCGGGAGCGGCGGCCAATATCAGTCCAGGCCTTGGCGTGGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail