Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3730
Gene name
LocationContig_334:12923..14924
Strand+
Gene length (bp)2001
Transcript length (bp)1944
Coding sequence length (bp)1944
Protein length (aa) 648

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 7.7E-41 148 531
PF00083 Sugar_tr Sugar (and other) transporter 5.1E-10 144 338

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 11 581 1.0E-153
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 124 576 3.0E-151
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 30 578 3.0E-150
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 72 576 3.0E-138
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 104 576 2.0E-131
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 11 581 1.0E-153
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 124 576 3.0E-151
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 30 578 3.0E-150
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 72 576 3.0E-138
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 104 576 2.0E-131
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 102 578 3.0E-131
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 115 577 1.0E-99
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 58 581 5.0E-95
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 115 581 4.0E-88
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 113 578 1.0E-85
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 56 574 3.0E-80
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 125 574 2.0E-79
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 126 578 2.0E-78
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 114 577 6.0E-76
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 113 578 3.0E-75
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 110 578 2.0E-72
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 125 578 1.0E-71
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 126 580 5.0E-69
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 126 580 9.0E-69
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 112 578 2.0E-68
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 116 578 2.0E-68
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 116 578 3.0E-68
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 118 578 7.0E-68
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 114 575 6.0E-63
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 111 580 1.0E-55
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 118 577 9.0E-43
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 124 590 9.0E-41
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 127 578 1.0E-37
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 129 353 5.0E-25
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 430 580 4.0E-17
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 155 551 2.0E-15
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 154 423 6.0E-15
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 129 351 9.0E-14
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 124 320 5.0E-13
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 138 470 2.0E-12
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 136 614 6.0E-11
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 138 573 3.0E-10
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 140 322 2.0E-08
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 181 362 2.0E-08
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 131 319 2.0E-08
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 147 298 2.0E-08
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 436 574 4.0E-08
sp|Q1RI77|BCRH_RICBR Uncharacterized transporter RBE_0856 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0856 PE=3 SV=1 155 305 6.0E-08
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 138 439 3.0E-07
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 122 319 5.0E-07
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 124 444 2.0E-06
sp|A8GCZ5|MDTG_SERP5 Multidrug resistance protein MdtG OS=Serratia proteamaculans (strain 568) GN=mdtG PE=3 SV=1 132 439 2.0E-06
sp|P37597|YDHC_ECOLI Inner membrane transport protein YdhC OS=Escherichia coli (strain K12) GN=ydhC PE=1 SV=3 154 319 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 140 162 22
2 177 199 22
3 206 225 19
4 231 253 22
5 266 288 22
6 293 315 22
7 372 394 22
8 409 428 19
9 449 471 22
10 476 498 22
11 511 533 22
12 543 565 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3730
MDDADREVISAEADAAAPEYYQRRNSDEVERIVSASSVSTASSMHTPGMRNRMSYISTHRDLDRHYTELSRIETQ
RTQHYGTVGSSAASVAAQHRKPLPLFGAGKPFPPPLPARDEYVVEFDGPGDPLNAQNWPTRVKVAMVAMLNYTTF
VTSFTSSIYSPAIETVSEFFHVNLETALLGTTLYVLGFAFGPTLWAPLSELRGRRLPIILSMFGFSVFCIGAATA
KDIATLLICRFFSGFFGSCSLAVVAAIFSDMFNNVTRGIAITCFTMTVFLGPFLAPFIGGYIVESYLGWRWTLYL
STILGFFAFFLDLFFLKESYAPVILVGKAGELRRRTRNWGIHAKQEEIEIDLAELINKNFSRPMRMLFTEPILFL
LTLYMSFLYGLLYLFLTAYNIVFVGIHHFSLGEAGLTFFGMIIGVLIAGLVVFAQQPWYTRKLKANNGVPVPEWR
LPSVMAGGICFVIGIFWFGWTGYKSSIPWAAPAASGIFTGFGLMSIFLQSINYIVDAYLMFAASALAGNTFMRSL
AGATFPLFARQMFLGMGVQWASTLLGCLALLMCPIPFIFYKYGSRLREKSQFAPTLPRPPRSHSSDDIGNGETMT
ETEKRKRDRSAATSRDTAVLSTRSASARGDESLLTGDSDSLGPRLDV*
Coding >Ophun1|3730
ATGGACGACGCCGACCGAGAGGTCATCTCCGCCGAGGCCGATGCCGCCGCTCCAGAATACTATCAGCGGCGGAAC
AGCGATGAGGTCGAACGTATCGTCTCGGCTTCGTCCGTCTCGACGGCTTCGTCGATGCACACGCCTGGCATGCGC
AACCGCATGAGCTACATCTCGACTCATCGCGATCTCGACCGTCACTACACCGAGCTGAGCCGGATCGAGACGCAG
CGTACGCAGCATTACGGCACCGTCGGTAGCTCTGCTGCCAGTGTTGCCGCTCAACATCGCAAGCCCTTGCCTTTG
TTTGGCGCTGGGAAGCCGTTTCCACCGCCTCTGCCGGCTCGGGACGAGTATGTCGTCGAGTTTGATGGGCCTGGC
GATCCTCTCAATGCTCAGAACTGGCCTACGCGCGTCAAAGTGGCCATGGTCGCCATGCTCAACTATACAACCTTT
GTCACGTCCTTTACCTCGTCCATCTACTCGCCTGCCATCGAGACCGTCTCCGAGTTCTTTCACGTCAACCTCGAG
ACCGCTCTGCTCGGGACGACGCTCTACGTTCTCGGCTTCGCTTTCGGTCCCACGCTGTGGGCGCCCCTTTCCGAG
CTTCGCGGTCGCCGGCTGCCCATCATCCTCTCCATGTTTGGTTTCTCCGTCTTCTGCATCGGCGCCGCTACGGCA
AAGGACATTGCGACGCTCCTCATCTGCCGCTTCTTCTCCGGCTTCTTCGGCTCCTGTTCTCTCGCCGTCGTGGCA
GCCATCTTCTCCGACATGTTCAACAACGTGACGCGCGGGATTGCAATCACCTGCTTCACCATGACCGTCTTCCTG
GGGCCCTTTCTCGCCCCTTTTATCGGCGGCTATATCGTCGAGTCCTACCTCGGCTGGCGCTGGACCTTGTATCTG
TCCACCATTCTCGGCTTCTTCGCCTTCTTTCTCGACCTCTTCTTCCTCAAGGAGTCTTACGCGCCCGTCATTCTC
GTCGGCAAGGCTGGAGAGCTGCGCCGTCGCACTCGCAACTGGGGCATTCACGCCAAGCAGGAAGAGATTGAGATT
GACCTTGCCGAGCTCATCAACAAGAACTTTTCTCGTCCCATGCGTATGCTCTTTACCGAGCCCATTCTATTTCTC
CTCACCCTCTACATGAGCTTTCTCTACGGCTTGCTCTACCTCTTCCTCACCGCTTACAACATCGTCTTTGTTGGC
ATCCACCACTTCAGCTTGGGCGAGGCCGGCCTGACCTTTTTCGGCATGATCATTGGCGTCCTCATCGCCGGCCTT
GTCGTCTTCGCCCAGCAGCCGTGGTATACGCGCAAGCTGAAGGCCAACAACGGCGTCCCGGTCCCCGAGTGGAGG
TTACCCAGCGTCATGGCCGGTGGCATCTGCTTCGTCATTGGCATCTTCTGGTTTGGATGGACCGGATACAAGTCC
AGCATCCCCTGGGCAGCCCCCGCCGCCAGCGGCATCTTCACCGGCTTCGGACTCATGTCCATCTTTCTGCAATCC
ATCAACTACATCGTCGACGCCTACCTCATGTTCGCCGCCTCAGCCCTCGCCGGCAACACCTTTATGCGCTCCCTC
GCCGGCGCAACCTTTCCGCTCTTTGCGAGACAGATGTTCCTGGGCATGGGTGTCCAGTGGGCGTCGACGCTGCTG
GGGTGTCTGGCGCTGCTCATGTGCCCGATCCCCTTCATCTTCTACAAGTACGGCAGCCGGCTCCGGGAGAAGAGC
CAGTTCGCGCCGACGCTACCGCGGCCGCCTCGCTCCCACTCGTCCGACGACATCGGCAACGGCGAGACTATGACG
GAGACGGAGAAGAGGAAGCGCGATCGCTCGGCTGCCACCAGTCGGGACACGGCCGTTCTCAGCACCCGCTCGGCC
TCGGCGAGGGGCGATGAGAGCCTGCTCACTGGGGACAGCGACAGTTTGGGTCCCCGGCTGGACGTATAG
Transcript >Ophun1|3730
ATGGACGACGCCGACCGAGAGGTCATCTCCGCCGAGGCCGATGCCGCCGCTCCAGAATACTATCAGCGGCGGAAC
AGCGATGAGGTCGAACGTATCGTCTCGGCTTCGTCCGTCTCGACGGCTTCGTCGATGCACACGCCTGGCATGCGC
AACCGCATGAGCTACATCTCGACTCATCGCGATCTCGACCGTCACTACACCGAGCTGAGCCGGATCGAGACGCAG
CGTACGCAGCATTACGGCACCGTCGGTAGCTCTGCTGCCAGTGTTGCCGCTCAACATCGCAAGCCCTTGCCTTTG
TTTGGCGCTGGGAAGCCGTTTCCACCGCCTCTGCCGGCTCGGGACGAGTATGTCGTCGAGTTTGATGGGCCTGGC
GATCCTCTCAATGCTCAGAACTGGCCTACGCGCGTCAAAGTGGCCATGGTCGCCATGCTCAACTATACAACCTTT
GTCACGTCCTTTACCTCGTCCATCTACTCGCCTGCCATCGAGACCGTCTCCGAGTTCTTTCACGTCAACCTCGAG
ACCGCTCTGCTCGGGACGACGCTCTACGTTCTCGGCTTCGCTTTCGGTCCCACGCTGTGGGCGCCCCTTTCCGAG
CTTCGCGGTCGCCGGCTGCCCATCATCCTCTCCATGTTTGGTTTCTCCGTCTTCTGCATCGGCGCCGCTACGGCA
AAGGACATTGCGACGCTCCTCATCTGCCGCTTCTTCTCCGGCTTCTTCGGCTCCTGTTCTCTCGCCGTCGTGGCA
GCCATCTTCTCCGACATGTTCAACAACGTGACGCGCGGGATTGCAATCACCTGCTTCACCATGACCGTCTTCCTG
GGGCCCTTTCTCGCCCCTTTTATCGGCGGCTATATCGTCGAGTCCTACCTCGGCTGGCGCTGGACCTTGTATCTG
TCCACCATTCTCGGCTTCTTCGCCTTCTTTCTCGACCTCTTCTTCCTCAAGGAGTCTTACGCGCCCGTCATTCTC
GTCGGCAAGGCTGGAGAGCTGCGCCGTCGCACTCGCAACTGGGGCATTCACGCCAAGCAGGAAGAGATTGAGATT
GACCTTGCCGAGCTCATCAACAAGAACTTTTCTCGTCCCATGCGTATGCTCTTTACCGAGCCCATTCTATTTCTC
CTCACCCTCTACATGAGCTTTCTCTACGGCTTGCTCTACCTCTTCCTCACCGCTTACAACATCGTCTTTGTTGGC
ATCCACCACTTCAGCTTGGGCGAGGCCGGCCTGACCTTTTTCGGCATGATCATTGGCGTCCTCATCGCCGGCCTT
GTCGTCTTCGCCCAGCAGCCGTGGTATACGCGCAAGCTGAAGGCCAACAACGGCGTCCCGGTCCCCGAGTGGAGG
TTACCCAGCGTCATGGCCGGTGGCATCTGCTTCGTCATTGGCATCTTCTGGTTTGGATGGACCGGATACAAGTCC
AGCATCCCCTGGGCAGCCCCCGCCGCCAGCGGCATCTTCACCGGCTTCGGACTCATGTCCATCTTTCTGCAATCC
ATCAACTACATCGTCGACGCCTACCTCATGTTCGCCGCCTCAGCCCTCGCCGGCAACACCTTTATGCGCTCCCTC
GCCGGCGCAACCTTTCCGCTCTTTGCGAGACAGATGTTCCTGGGCATGGGTGTCCAGTGGGCGTCGACGCTGCTG
GGGTGTCTGGCGCTGCTCATGTGCCCGATCCCCTTCATCTTCTACAAGTACGGCAGCCGGCTCCGGGAGAAGAGC
CAGTTCGCGCCGACGCTACCGCGGCCGCCTCGCTCCCACTCGTCCGACGACATCGGCAACGGCGAGACTATGACG
GAGACGGAGAAGAGGAAGCGCGATCGCTCGGCTGCCACCAGTCGGGACACGGCCGTTCTCAGCACCCGCTCGGCC
TCGGCGAGGGGCGATGAGAGCCTGCTCACTGGGGACAGCGACAGTTTGGGTCCCCGGCTGGACGTATAG
Gene >Ophun1|3730
ATGGACGACGCCGACCGAGAGGTCATCTCCGCCGAGGCCGATGCCGCCGCTCCAGAATACTATCAGCGGCGGAAC
AGCGATGAGGTCGAACGTATCGTCTCGGCTTCGTCCGTCTCGACGGCTTCGTCGATGCACACGCCTGGCATGCGC
AACCGCATGAGCTACATCTCGACTCATCGCGATCTCGACCGTCACTACACCGAGCTGAGCCGGATCGAGACGCAG
CGTACGCAGCATTACGGCACCGTCGGTAGCTCTGCTGCCAGTGTTGCCGCTCAACATCGCAAGCCCTTGCCTTTG
TTTGGCGCTGGGAAGCCGTTTCCACCGCCTCTGCCGGCTCGGGACGAGTATGTCGTCGAGTTTGATGGGCCTGGC
GATCCTCTCAATGCTCAGAACTGGCCTACGCGCGTCAAAGTGGCCATGGTCGCCATGCTCAACTATACAACCTTT
GTCACGTCCTTTACCTCGTCCATCTACTCGCCTGCCATCGAGACCGTCTCCGAGTTCTTTCACGTCAACCTCGAG
ACCGCTCTGCTCGGGACGACGCTCTACGTTCTCGGCTTCGCTTTCGGTCCCACGCTGTGGGCGCCCCTTTCCGAG
CTTCGCGGTCGCCGGCTGCCCATCATCCTCTCCATGTTTGGTTTCTCCGTCTTCTGCATCGGCGCCGCTACGGCA
AAGGACATTGCGACGCTCCTCATCTGCCGCTTCTTCTCCGGCTTCTTCGGCTCCTGTTCTCTCGCCGTCGTGGCA
GCCATCTTCTCCGACATGTTCAACAACGTGACGCGCGGGATTGCAATCACCTGCTTCACCATGACCGTCTTCCTG
GGGCCCTTTCTCGCCCCTTTTATCGGCGGCTATATCGTCGAGTCCTACCTCGGCTGGCGCTGGACCTTGTATCTG
TCCACCATTCTCGGCTTCTTCGCCTTCTTTCTCGACCTCTTCTTCCTCAAGGAGTCTTACGCGCCCGTCATTCTC
GTCGGCAAGGCTGGAGAGCTGCGCCGTCGCACTCGCAACTGGGGCATTCACGCCAAGCAGGAAGAGATTGAGATT
GACCTTGCCGAGCTCATCAACAAGAACTTTTCTCGTCCCATGCGTATGCTCTTTACCGAGCCCATTCTATTTCTC
CTCACCCTCTACATGAGCTTTCTCTACGGCTTGCTCTACCTCTTCCTCACCGCTTACAACATCGTCTTTGTTGGC
ATCCACCACTTCAGCTTGGGCGAGGCCGGCCTGACCTTTTTCGGCATGATCATTGGCGTCCTCATCGCCGGCCTT
GTCGTCTTCGCCCAGCAGCCGTGGTATACGCGCAAGCTGAAGGCCAACAACGGCGTCCCGGTCCCCGAGTGGAGG
TTACCCAGCGTCATGGCCGGTGGCATCTGCTTCGTCATTGGCATCTTCTGGTTTGGATGGTACGTTTTATACACG
TCTTTTTTCCTTGTCAGGGCATTCGCTAACTTGACTTGCAGGACCGGATACAAGTCCAGCATCCCCTGGGCAGCC
CCCGCCGCCAGCGGCATCTTCACCGGCTTCGGACTCATGTCCATCTTTCTGCAATCCATCAACTACATCGTCGAC
GCCTACCTCATGTTCGCCGCCTCAGCCCTCGCCGGCAACACCTTTATGCGCTCCCTCGCCGGCGCAACCTTTCCG
CTCTTTGCGAGACAGATGTTCCTGGGCATGGGTGTCCAGTGGGCGTCGACGCTGCTGGGGTGTCTGGCGCTGCTC
ATGTGCCCGATCCCCTTCATCTTCTACAAGTACGGCAGCCGGCTCCGGGAGAAGAGCCAGTTCGCGCCGACGCTA
CCGCGGCCGCCTCGCTCCCACTCGTCCGACGACATCGGCAACGGCGAGACTATGACGGAGACGGAGAAGAGGAAG
CGCGATCGCTCGGCTGCCACCAGTCGGGACACGGCCGTTCTCAGCACCCGCTCGGCCTCGGCGAGGGGCGATGAG
AGCCTGCTCACTGGGGACAGCGACAGTTTGGGTCCCCGGCTGGACGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail