Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3726
Gene name
LocationContig_334:37..406
Strand-
Gene length (bp)369
Transcript length (bp)369
Coding sequence length (bp)369
Protein length (aa) 123

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.955399

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup547
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4177
Ophiocordyceps australis map64 (Brazil) OphauB2|6260
Ophiocordyceps camponoti-floridani Ophcf2|04329
Ophiocordyceps camponoti-rufipedis Ophun1|3726 (this protein)
Ophiocordyceps kimflemingae Ophio5|1611
Ophiocordyceps subramaniannii Hirsu2|3955
Ophiocordyceps subramaniannii Hirsu2|5674

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3726
MRASLPASVCCLLGLAAAAATVKPDIAIQARRLVVRADNSSNPVLNPRPTLPTPSNRLANRPGPQLRILCAGDSI
TAGSFSDLDGGDGNGYRLRLRDDLSGESSMCDADTGASQLTANCLSR*
Coding >Ophun1|3726
ATGCGGGCCTCTCTACCGGCGTCCGTCTGCTGCCTGCTCGGGCTCGCCGCTGCCGCCGCCACCGTCAAGCCAGAC
ATCGCGATCCAGGCCCGAAGGCTGGTGGTCAGGGCCGACAATTCCTCGAATCCCGTCTTGAATCCACGTCCGACG
CTGCCGACGCCAAGCAATCGCCTTGCCAATCGGCCCGGGCCGCAGCTGCGCATCCTATGCGCCGGCGACTCCATC
ACGGCCGGGTCTTTCAGCGACTTAGACGGCGGCGACGGAAATGGCTATAGGCTTCGGCTGCGAGACGACTTGTCG
GGTGAGTCGTCCATGTGCGACGCTGACACCGGGGCTTCCCAACTGACAGCCAATTGTCTCAGCCGATAG
Transcript >Ophun1|3726
ATGCGGGCCTCTCTACCGGCGTCCGTCTGCTGCCTGCTCGGGCTCGCCGCTGCCGCCGCCACCGTCAAGCCAGAC
ATCGCGATCCAGGCCCGAAGGCTGGTGGTCAGGGCCGACAATTCCTCGAATCCCGTCTTGAATCCACGTCCGACG
CTGCCGACGCCAAGCAATCGCCTTGCCAATCGGCCCGGGCCGCAGCTGCGCATCCTATGCGCCGGCGACTCCATC
ACGGCCGGGTCTTTCAGCGACTTAGACGGCGGCGACGGAAATGGCTATAGGCTTCGGCTGCGAGACGACTTGTCG
GGTGAGTCGTCCATGTGCGACGCTGACACCGGGGCTTCCCAACTGACAGCCAATTGTCTCAGCCGATAG
Gene >Ophun1|3726
ATGCGGGCCTCTCTACCGGCGTCCGTCTGCTGCCTGCTCGGGCTCGCCGCTGCCGCCGCCACCGTCAAGCCAGAC
ATCGCGATCCAGGCCCGAAGGCTGGTGGTCAGGGCCGACAATTCCTCGAATCCCGTCTTGAATCCACGTCCGACG
CTGCCGACGCCAAGCAATCGCCTTGCCAATCGGCCCGGGCCGCAGCTGCGCATCCTATGCGCCGGCGACTCCATC
ACGGCCGGGTCTTTCAGCGACTTAGACGGCGGCGACGGAAATGGCTATAGGCTTCGGCTGCGAGACGACTTGTCG
GGTGAGTCGTCCATGTGCGACGCTGACACCGGGGCTTCCCAACTGACAGCCAATTGTCTCAGCCGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail