Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3723
Gene name
LocationContig_333:12064..13608
Strand-
Gene length (bp)1544
Transcript length (bp)1446
Coding sequence length (bp)1446
Protein length (aa) 482

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01148 CTP_transf_1 Cytidylyltransferase family 6.2E-79 76 425

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P381|CDSH_SCHPO Putative phosphatidate cytidylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13A2.03 PE=1 SV=1 28 471 6.0E-157
sp|P38221|CDS1_YEAST Phosphatidate cytidylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDS1 PE=1 SV=1 13 469 2.0E-134
sp|O49639|CDS2_ARATH Phosphatidate cytidylyltransferase 2 OS=Arabidopsis thaliana GN=CDS2 PE=1 SV=1 69 467 3.0E-100
sp|O04928|CDS1_ARATH Phosphatidate cytidylyltransferase 1 OS=Arabidopsis thaliana GN=CDS1 PE=1 SV=1 68 463 2.0E-98
sp|Q99L43|CDS2_MOUSE Phosphatidate cytidylyltransferase 2 OS=Mus musculus GN=Cds2 PE=1 SV=1 17 470 4.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P381|CDSH_SCHPO Putative phosphatidate cytidylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13A2.03 PE=1 SV=1 28 471 6.0E-157
sp|P38221|CDS1_YEAST Phosphatidate cytidylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDS1 PE=1 SV=1 13 469 2.0E-134
sp|O49639|CDS2_ARATH Phosphatidate cytidylyltransferase 2 OS=Arabidopsis thaliana GN=CDS2 PE=1 SV=1 69 467 3.0E-100
sp|O04928|CDS1_ARATH Phosphatidate cytidylyltransferase 1 OS=Arabidopsis thaliana GN=CDS1 PE=1 SV=1 68 463 2.0E-98
sp|Q99L43|CDS2_MOUSE Phosphatidate cytidylyltransferase 2 OS=Mus musculus GN=Cds2 PE=1 SV=1 17 470 4.0E-98
sp|A0JNC1|CDS2_BOVIN Phosphatidate cytidylyltransferase 2 OS=Bos taurus GN=CDS2 PE=2 SV=1 16 467 4.0E-98
sp|O95674|CDS2_HUMAN Phosphatidate cytidylyltransferase 2 OS=Homo sapiens GN=CDS2 PE=1 SV=1 22 467 7.0E-97
sp|Q91XU8|CDS2_RAT Phosphatidate cytidylyltransferase 2 OS=Rattus norvegicus GN=Cds2 PE=1 SV=1 17 466 1.0E-96
sp|Q92903|CDS1_HUMAN Phosphatidate cytidylyltransferase 1 OS=Homo sapiens GN=CDS1 PE=2 SV=2 7 467 4.0E-96
sp|O35052|CDS1_RAT Phosphatidate cytidylyltransferase 1 OS=Rattus norvegicus GN=Cds1 PE=1 SV=2 19 467 2.0E-95
sp|P98191|CDS1_MOUSE Phosphatidate cytidylyltransferase 1 OS=Mus musculus GN=Cds1 PE=1 SV=2 19 467 4.0E-95
sp|O04940|CDS1_SOLTU Phosphatidate cytidylyltransferase 1 OS=Solanum tuberosum GN=CDS1 PE=1 SV=1 19 458 2.0E-91
sp|Q1PE48|CDS3_ARATH Phosphatidate cytidylyltransferase 3 OS=Arabidopsis thaliana GN=CDS3 PE=1 SV=1 44 463 5.0E-86
sp|P56079|CDSA_DROME Phosphatidate cytidylyltransferase, photoreceptor-specific OS=Drosophila melanogaster GN=CdsA PE=1 SV=2 1 462 6.0E-86
sp|P53439|CDSA_CAEEL Phosphatidate cytidylyltransferase OS=Caenorhabditis elegans GN=cdgs-1 PE=3 SV=2 35 466 1.0E-85
sp|Q55D90|CDSA_DICDI Probable phosphatidate cytidylyltransferase OS=Dictyostelium discoideum GN=cdsA PE=3 SV=1 84 451 2.0E-72
sp|Q95ZE3|CDS1_ENCCU Phosphatidate cytidylyltransferase OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDS1 PE=3 SV=1 173 458 6.0E-41
sp|P75160|CDSA_MYCPN Putative phosphatidate cytidylyltransferase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=cdsA PE=3 SV=1 222 409 4.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 89 111 22
2 132 154 22
3 169 188 19
4 201 220 19
5 230 252 22
6 265 287 22
7 362 384 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3723
MGRSSAKRGVRFPHGAAVNGQASGSDGRRSSFSGSDEGSGSPSRTRSKAQAQLAPVQEKQAASEDEYQKKKQNFI
TRTFWTFSMLAMFFTALFMGHIYIIAIVTAVQIVSFKEVIAISNVPSRARSIRSTKSINWYWLATTMYFLYGESV
IYYFKHVVLVDRVLLPLGIHHRFISFILYVFGFVCFVGTLKAGNYKFQFTNFAWTHMALYLIVVQAHFVMNNIFE
GMIWFFLPAALVIVNDIFAYICGIAFGRTQLIKLSPKKTVEGFVGAWFMTVVFASLLVSLMIRSKYFICPVNVSR
LSTVFERVPMLTLRGQDLGANIFTGLECEPNPVFLPHTYNLPHLFFLPANTTFSLTFAPMQLHAFVLATFASLIA
PFGGFFASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGFFAYMYYHTFVEVHKVTMGSVLEKAITSLSPDQQV
ELVKSMARYLGNQGVVSEKVVSCIDDAMAKR*
Coding >Ophun1|3723
ATGGGCCGGTCTTCCGCAAAGAGGGGCGTCCGCTTCCCCCACGGCGCCGCCGTCAACGGCCAGGCCTCGGGATCA
GATGGTCGTCGCTCCAGCTTTAGCGGCTCCGATGAGGGATCCGGCTCGCCGTCGAGGACCCGCTCCAAGGCTCAG
GCTCAGCTGGCTCCCGTCCAGGAGAAGCAAGCCGCATCCGAGGACGAGTACCAGAAGAAGAAGCAGAACTTCATC
ACACGCACCTTTTGGACCTTTAGCATGCTCGCCATGTTCTTCACCGCCCTCTTCATGGGCCACATCTACATCATA
GCCATCGTCACCGCCGTCCAGATTGTCTCCTTCAAAGAGGTCATTGCCATCTCCAACGTGCCCAGTCGCGCCCGT
TCGATCCGGTCCACCAAGAGCATCAACTGGTACTGGCTGGCCACCACCATGTACTTTCTCTACGGCGAGAGCGTC
ATCTACTACTTCAAGCATGTTGTTCTCGTTGACAGGGTGTTGCTGCCCCTCGGTATTCATCACCGCTTCATCAGC
TTCATCCTCTACGTCTTTGGCTTTGTCTGCTTCGTCGGCACTCTCAAAGCCGGAAACTACAAGTTCCAGTTTACA
AACTTTGCCTGGACGCACATGGCGCTCTACCTCATCGTCGTCCAGGCTCACTTTGTCATGAACAACATCTTTGAG
GGCATGATCTGGTTCTTCTTGCCGGCCGCTCTCGTCATTGTCAACGACATCTTTGCCTACATCTGTGGAATCGCC
TTTGGCCGTACTCAGCTCATCAAGTTGTCGCCCAAGAAGACGGTCGAGGGCTTCGTCGGCGCCTGGTTCATGACG
GTCGTCTTTGCCTCGCTGCTCGTCAGCCTCATGATTCGCTCCAAGTACTTCATCTGCCCCGTCAATGTGAGCCGT
CTCAGTACCGTGTTTGAGAGGGTGCCCATGCTGACGCTTCGAGGACAGGACCTTGGAGCCAACATCTTTACCGGC
CTCGAATGCGAGCCGAATCCCGTCTTCCTCCCTCACACCTACAATCTGCCTCACCTATTCTTTCTGCCGGCCAAT
ACGACGTTTTCGCTCACGTTTGCGCCGATGCAGCTCCACGCCTTTGTGCTGGCGACGTTTGCCTCTCTCATCGCC
CCCTTTGGCGGTTTCTTCGCTTCGGGCCTCAAGCGGACTTTCAAGATCAAGGACTTTGGCGACTCGATCCCCGGC
CACGGTGGTATGACGGACCGGATGGATTGCCAGTTCATCATGGGCTTCTTCGCCTACATGTACTACCATACCTTT
GTCGAGGTGCACAAGGTGACGATGGGCTCGGTGCTGGAAAAGGCCATTACCAGCCTGAGCCCGGACCAGCAGGTC
GAGCTGGTCAAGAGCATGGCTCGCTATCTGGGCAACCAGGGCGTCGTGTCGGAAAAGGTGGTCAGCTGCATCGAC
GACGCCATGGCCAAGCGATGA
Transcript >Ophun1|3723
ATGGGCCGGTCTTCCGCAAAGAGGGGCGTCCGCTTCCCCCACGGCGCCGCCGTCAACGGCCAGGCCTCGGGATCA
GATGGTCGTCGCTCCAGCTTTAGCGGCTCCGATGAGGGATCCGGCTCGCCGTCGAGGACCCGCTCCAAGGCTCAG
GCTCAGCTGGCTCCCGTCCAGGAGAAGCAAGCCGCATCCGAGGACGAGTACCAGAAGAAGAAGCAGAACTTCATC
ACACGCACCTTTTGGACCTTTAGCATGCTCGCCATGTTCTTCACCGCCCTCTTCATGGGCCACATCTACATCATA
GCCATCGTCACCGCCGTCCAGATTGTCTCCTTCAAAGAGGTCATTGCCATCTCCAACGTGCCCAGTCGCGCCCGT
TCGATCCGGTCCACCAAGAGCATCAACTGGTACTGGCTGGCCACCACCATGTACTTTCTCTACGGCGAGAGCGTC
ATCTACTACTTCAAGCATGTTGTTCTCGTTGACAGGGTGTTGCTGCCCCTCGGTATTCATCACCGCTTCATCAGC
TTCATCCTCTACGTCTTTGGCTTTGTCTGCTTCGTCGGCACTCTCAAAGCCGGAAACTACAAGTTCCAGTTTACA
AACTTTGCCTGGACGCACATGGCGCTCTACCTCATCGTCGTCCAGGCTCACTTTGTCATGAACAACATCTTTGAG
GGCATGATCTGGTTCTTCTTGCCGGCCGCTCTCGTCATTGTCAACGACATCTTTGCCTACATCTGTGGAATCGCC
TTTGGCCGTACTCAGCTCATCAAGTTGTCGCCCAAGAAGACGGTCGAGGGCTTCGTCGGCGCCTGGTTCATGACG
GTCGTCTTTGCCTCGCTGCTCGTCAGCCTCATGATTCGCTCCAAGTACTTCATCTGCCCCGTCAATGTGAGCCGT
CTCAGTACCGTGTTTGAGAGGGTGCCCATGCTGACGCTTCGAGGACAGGACCTTGGAGCCAACATCTTTACCGGC
CTCGAATGCGAGCCGAATCCCGTCTTCCTCCCTCACACCTACAATCTGCCTCACCTATTCTTTCTGCCGGCCAAT
ACGACGTTTTCGCTCACGTTTGCGCCGATGCAGCTCCACGCCTTTGTGCTGGCGACGTTTGCCTCTCTCATCGCC
CCCTTTGGCGGTTTCTTCGCTTCGGGCCTCAAGCGGACTTTCAAGATCAAGGACTTTGGCGACTCGATCCCCGGC
CACGGTGGTATGACGGACCGGATGGATTGCCAGTTCATCATGGGCTTCTTCGCCTACATGTACTACCATACCTTT
GTCGAGGTGCACAAGGTGACGATGGGCTCGGTGCTGGAAAAGGCCATTACCAGCCTGAGCCCGGACCAGCAGGTC
GAGCTGGTCAAGAGCATGGCTCGCTATCTGGGCAACCAGGGCGTCGTGTCGGAAAAGGTGGTCAGCTGCATCGAC
GACGCCATGGCCAAGCGATGA
Gene >Ophun1|3723
ATGGGCCGGTCTTCCGCAAAGAGGGGCGTCCGCTTCCCCCACGGCGCCGCCGTCAACGGCCAGGCCTCGGGATCA
GATGGTCGTCGCTCCAGCTTTAGCGGCTCCGATGAGGGATCCGGCTCGCCGTCGAGGACCCGCTCCAAGGCTCAG
GCTCAGCTGGCTCCCGTCCAGGAGGTTGGTTCTCGCTGCCTCCCCGTGAACCGACGCTGACTCTCTTGTTCGCAG
AAGCAAGCCGCATCCGAGGACGAGTACCAGAAGAAGAAGCAGAACTTCATCACACGCACCTTTTGGACCTTTAGC
ATGCTCGCCATGTTCTTCACCGCCCTCTTCATGGGCCACATCTACATCATAGCCATCGTCACCGCCGTCCAGATT
GTCTCCTTCAAAGAGGTCATTGCCATCTCCAACGTGCCCAGTCGCGCCCGTTCGATCCGGTCCACCAAGAGCATC
AACTGGTACTGGCTGGCCACCACCATGTACTTTCTCTACGGCGAGAGCGTCATCTACTACTTCAAGCATGTTGTT
CTCGTTGACAGGGTGTTGCTGCCCCTCGGTATTCATCACCGCTTCATCAGCTTCATCCTCTACGTCTTTGGTCAG
TCCCTTTTTCTTTAGTTGTGACTCTAGTCTGACACTCGGCAGGCTTTGTCTGCTTCGTCGGCACTCTCAAAGCCG
GAAACTACAAGTTCCAGTTTACAAACTTTGCCTGGACGCACATGGCGCTCTACCTCATCGTCGTCCAGGCTCACT
TTGTCATGAACAACATCTTTGAGGGCATGATCTGGTTCTTCTTGCCGGCCGCTCTCGTCATTGTCAACGACATCT
TTGCCTACATCTGTGGAATCGCCTTTGGCCGTACTCAGCTCATCAAGTTGTCGCCCAAGAAGACGGTCGAGGGCT
TCGTCGGCGCCTGGTTCATGACGGTCGTCTTTGCCTCGCTGCTCGTCAGCCTCATGATTCGCTCCAAGTACTTCA
TCTGCCCCGTCAATGTGAGCCGTCTCAGTACCGTGTTTGAGAGGGTGCCCATGCTGACGCTTCGAGGACAGGACC
TTGGAGCCAACATCTTTACCGGCCTCGAATGCGAGCCGAATCCCGTCTTCCTCCCTCACACCTACAATCTGCCTC
ACCTATTCTTTCTGCCGGCCAATACGACGTTTTCGCTCACGTTTGCGCCGATGCAGCTCCACGCCTTTGTGCTGG
CGACGTTTGCCTCTCTCATCGCCCCCTTTGGCGGTTTCTTCGCTTCGGGCCTCAAGCGGACTTTCAAGATCAAGG
ACTTTGGCGACTCGATCCCCGGCCACGGTGGTATGACGGACCGGATGGATTGCCAGTTCATCATGGGCTTCTTCG
CCTACATGTACTACCATACCTTTGTCGAGGTGCACAAGGTGACGATGGGCTCGGTGCTGGAAAAGGCCATTACCA
GCCTGAGCCCGGACCAGCAGGTCGAGCTGGTCAAGAGCATGGCTCGCTATCTGGGCAACCAGGGCGTCGTGTCGG
AAAAGGTGGTCAGCTGCATCGACGACGCCATGGCCAAGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail