Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3713
Gene name
LocationContig_331:15792..18230
Strand-
Gene length (bp)2438
Transcript length (bp)2376
Coding sequence length (bp)2376
Protein length (aa) 792

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05970 PIF1 PIF1-like helicase 4.6E-47 280 489
PF05970 PIF1 PIF1-like helicase 1.6E-13 506 586
PF13604 AAA_30 AAA domain 6.8E-22 279 488
PF13245 AAA_19 AAA domain 3.7E-12 295 431
PF13401 AAA_22 AAA domain 1.1E-07 294 423
PF12775 AAA_7 P-loop containing dynein motor region 1.3E-06 275 322
PF00004 AAA ATPase family associated with various cellular activities (AAA) 1.4E-04 298 390

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AXT5|PIF1_EMENI ATP-dependent DNA helicase PIF1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pif1 PE=3 SV=2 198 744 0.0E+00
sp|Q9UUA2|PIF1_SCHPO ATP-dependent DNA helicase pfh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfh1 PE=1 SV=1 102 760 6.0E-178
sp|Q59RQ0|PIF1_CANAL ATP-dependent DNA helicase PIF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIF1 PE=3 SV=1 267 746 6.0E-143
sp|P38766|RRM3_YEAST ATP-dependent DNA helicase RRM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRM3 PE=1 SV=1 277 741 3.0E-122
sp|A6ZM04|PIF1_YEAS7 ATP-dependent DNA helicase PIF1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PIF1 PE=3 SV=1 276 622 2.0E-107
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AXT5|PIF1_EMENI ATP-dependent DNA helicase PIF1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pif1 PE=3 SV=2 198 744 0.0E+00
sp|Q9UUA2|PIF1_SCHPO ATP-dependent DNA helicase pfh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfh1 PE=1 SV=1 102 760 6.0E-178
sp|Q59RQ0|PIF1_CANAL ATP-dependent DNA helicase PIF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIF1 PE=3 SV=1 267 746 6.0E-143
sp|P38766|RRM3_YEAST ATP-dependent DNA helicase RRM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRM3 PE=1 SV=1 277 741 3.0E-122
sp|A6ZM04|PIF1_YEAS7 ATP-dependent DNA helicase PIF1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PIF1 PE=3 SV=1 276 622 2.0E-107
sp|P07271|PIF1_YEAST ATP-dependent DNA helicase PIF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIF1 PE=1 SV=2 175 622 2.0E-106
sp|Q0R4F1|PIF1_XENLA ATP-dependent DNA helicase PIF1 OS=Xenopus laevis GN=pif1 PE=2 SV=1 267 748 3.0E-100
sp|Q9H611|PIF1_HUMAN ATP-dependent DNA helicase PIF1 OS=Homo sapiens GN=PIF1 PE=1 SV=2 257 741 6.0E-98
sp|Q1HG60|PIF1_RAT ATP-dependent DNA helicase PIF1 OS=Rattus norvegicus GN=Pif1 PE=2 SV=1 280 741 2.0E-97
sp|Q80SX8|PIF1_MOUSE ATP-dependent DNA helicase PIF1 OS=Mus musculus GN=Pif1 PE=1 SV=2 280 741 4.0E-94
sp|Q7ZV90|PIF1_DANRE ATP-dependent DNA helicase PIF1 OS=Danio rerio GN=pif1 PE=2 SV=1 272 741 5.0E-91
sp|A5WFR0|PIF1_PSYWF ATP-dependent DNA helicase pif1 OS=Psychrobacter sp. (strain PRwf-1) GN=pif1 PE=3 SV=1 291 724 8.0E-72
sp|Q57YG0|PIF7_TRYB2 ATP-dependent DNA helicase PIF7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIF7 PE=3 SV=1 280 748 5.0E-71
sp|Q196V4|VF030_IIV3 Uncharacterized protein 106R OS=Invertebrate iridescent virus 3 GN=IIV3-106R PE=3 SV=1 277 737 2.0E-64
sp|Q38CE9|PIF6_TRYB2 ATP-dependent DNA helicase PIF6 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIF6 PE=3 SV=1 281 770 5.0E-61
sp|Q9QSK3|VF030_IIV6 Uncharacterized protein 030L OS=Invertebrate iridescent virus 6 GN=IIV6-030L PE=3 SV=1 280 748 2.0E-60
sp|Q6MHJ5|PIF1_BDEBA ATP-dependent DNA helicase pif1 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=pif1 PE=3 SV=1 278 738 1.0E-50
sp|Q580X6|PIF5_TRYB2 ATP-dependent DNA helicase PIF5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIF5 PE=1 SV=1 276 492 9.0E-43
sp|Q0P9V4|PIF1_CAMJE ATP-dependent DNA helicase pif1 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pif1 PE=3 SV=1 297 740 2.0E-35
sp|P07271|PIF1_YEAST ATP-dependent DNA helicase PIF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIF1 PE=1 SV=2 601 747 4.0E-34
sp|A6ZM04|PIF1_YEAS7 ATP-dependent DNA helicase PIF1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PIF1 PE=3 SV=1 601 747 4.0E-34
sp|Q383A1|PIF3_TRYB2 ATP-dependent DNA helicase PIF3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIF3 PE=3 SV=1 278 526 5.0E-25
sp|Q384Y1|PIF1_TRYB2 ATP-dependent DNA helicase PIF1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIF1 PE=1 SV=1 276 528 2.0E-22
sp|Q381V6|PIF4_TRYB2 ATP-dependent DNA helicase PIF4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIF4 PE=3 SV=1 278 535 5.0E-18
sp|Q384Y0|PIF2_TRYB2 ATP-dependent DNA helicase PIF2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIF2 PE=1 SV=1 280 550 3.0E-16
sp|Q580X6|PIF5_TRYB2 ATP-dependent DNA helicase PIF5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIF5 PE=1 SV=1 666 738 4.0E-14
sp|Q384Y0|PIF2_TRYB2 ATP-dependent DNA helicase PIF2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIF2 PE=1 SV=1 523 737 1.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0006281 DNA repair Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0000723 telomere maintenance Yes
GO:0003678 DNA helicase activity Yes
GO:0005524 ATP binding Yes
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032559 adenyl ribonucleotide binding No
GO:0050896 response to stimulus No
GO:0006725 cellular aromatic compound metabolic process No
GO:0071840 cellular component organization or biogenesis No
GO:0044260 cellular macromolecule metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0051716 cellular response to stimulus No
GO:0090304 nucleic acid metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0036094 small molecule binding No
GO:0006259 DNA metabolic process No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0008152 metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0032200 telomere organization No
GO:0097367 carbohydrate derivative binding No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0004386 helicase activity No
GO:0006950 response to stress No
GO:0000166 nucleotide binding No
GO:0016043 cellular component organization No
GO:0006996 organelle organization No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016787 hydrolase activity No
GO:0032555 purine ribonucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0008150 biological_process No
GO:0140097 catalytic activity, acting on DNA No
GO:0140657 ATP-dependent activity No
GO:0005488 binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0006974 cellular response to DNA damage stimulus No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0017111 nucleoside-triphosphatase activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0051276 chromosome organization No
GO:0033554 cellular response to stress No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3713
MFSRAKDQGPVAKQHSSSSSSSRSALAKHLFPSSSPAAPAGDLRDQFRKMGSAAAPTVQSPPSVSLGGRSPANAS
TRPAKAGQLQSLYGNSDSFKQEAVGRGLNVAASTSNSQAVYFAESDFSDDENLDLDYEAPQALPPLPKATMPPPP
VPAQSDTLIPWSSSPNTHFHPPKARQPIKPPLKRDSSGEVDDLDPSAQKRAKKRVLPANFRQTEPDVVEMPRGDV
GAARKAALLWDDLLPSADDVQKKLPRDQRNLQRGDSKGNVGSRAPSPAKAVPITLSTEQLHVLDLVVKKGRSVFF
TGPAGTGKSVLMKSIIRELKDKHRRDPERVAVTASTGLAACNIGGITLHSFSGIGLGKEDAQTLVKKIRRNPKAK
KRWERTKVLIIDEVSMVDGALFDKLSTIGRILRNNGRPWGGIQLVITGDFFQLPPVPDNSNQEPTKFAFDASTWS
TSIDHTIGLTQVFRQRDPKFAGMLNELRLGKISSDTEEAFKSLSRPLIFDDGVDSAQLYPTRQQVESSNEKRLRE
LPGQVHRFQATDSGDPTIKDKLLVNMMAPKSLDLKINAQVMLIKNLDDTLVNGSLGKVIAFSDENTFEMSSDAPR
EEAMEDDLAKAKRKLASFSHDPEGASRGSKPLFPVVRFISTGGKPRVILCQPEEWKVELPNGEVQAKRAQLPLIL
AWALSIHKAQGQTLERVTVDLGRVFEKGQAYVALSRATTQEGLRVLGFNKSKVMAHQRVIEFYGKLYSAEKALGG
YSSAKKPVKMADAVAQPRPQTGMTSAEAIDLDAEEAMASWG*
Coding >Ophun1|3713
ATGTTCTCCCGGGCCAAGGATCAAGGTCCGGTCGCCAAGCAGCATTCTTCTTCTTCGTCGTCATCGAGGAGCGCC
TTGGCCAAGCATCTCTTTCCTTCGAGCAGTCCCGCTGCCCCGGCCGGTGACCTGCGAGATCAATTCCGCAAGATG
GGCTCTGCGGCCGCTCCCACGGTACAGTCGCCGCCGAGCGTTTCCCTCGGTGGCCGCTCGCCCGCCAACGCGTCC
ACTCGTCCTGCCAAGGCTGGACAGCTGCAGTCGCTGTACGGCAACTCTGATTCCTTCAAACAGGAGGCTGTTGGT
AGAGGCCTGAACGTGGCCGCCAGCACCAGCAATTCTCAGGCTGTGTACTTTGCGGAGAGCGACTTTAGCGACGAT
GAGAATCTCGACCTGGACTACGAGGCTCCGCAAGCTCTTCCGCCTCTGCCGAAAGCTACCATGCCCCCGCCTCCT
GTGCCGGCACAGTCTGATACGCTCATCCCGTGGTCCTCTTCCCCGAATACCCATTTCCATCCTCCCAAGGCTCGC
CAACCAATCAAGCCGCCCTTGAAGCGCGATTCGTCCGGCGAAGTCGACGACCTCGACCCTTCTGCTCAGAAGAGG
GCCAAGAAGCGAGTGCTGCCGGCCAACTTCCGGCAAACCGAGCCCGATGTGGTGGAAATGCCGCGGGGAGATGTC
GGCGCCGCCCGGAAGGCGGCCTTGTTGTGGGATGACTTGCTCCCCAGCGCCGACGATGTACAGAAGAAGCTGCCT
AGGGATCAGCGGAACCTGCAACGAGGCGATTCAAAGGGTAACGTCGGATCTCGTGCTCCATCTCCGGCCAAGGCG
GTCCCCATCACCTTGAGCACCGAGCAGCTGCACGTACTGGATCTGGTCGTCAAAAAGGGCCGGAGCGTCTTCTTC
ACCGGCCCCGCTGGTACGGGCAAGTCGGTGCTCATGAAGTCCATCATCCGCGAGCTCAAGGACAAGCACCGCCGG
GACCCCGAGCGGGTGGCCGTGACGGCGTCTACTGGGTTGGCCGCCTGCAACATCGGAGGCATTACCCTGCACAGT
TTCTCGGGCATCGGTCTCGGTAAAGAAGACGCCCAAACGCTGGTCAAGAAGATTCGGCGAAACCCAAAGGCGAAA
AAGCGGTGGGAGAGGACAAAGGTTCTCATCATCGACGAGGTCTCCATGGTGGATGGGGCCCTCTTCGACAAGCTG
TCCACCATCGGGCGCATCTTGCGCAACAATGGCCGGCCCTGGGGCGGTATCCAGCTCGTCATCACCGGTGACTTC
TTCCAGCTGCCGCCCGTGCCAGACAACAGCAATCAAGAGCCGACCAAGTTCGCCTTTGACGCGTCTACGTGGAGC
ACGTCGATTGACCACACCATCGGCCTCACCCAAGTCTTTCGGCAGCGCGACCCCAAGTTTGCCGGCATGCTCAAC
GAGCTGCGGTTGGGCAAGATTAGCAGCGACACCGAGGAGGCCTTTAAAAGCTTGTCGAGACCGCTCATCTTTGAC
GACGGCGTCGACTCGGCCCAGCTGTATCCGACCCGGCAGCAGGTTGAGAGCTCCAACGAGAAGCGGCTTCGGGAG
CTGCCCGGACAGGTTCACCGGTTCCAGGCGACCGATTCGGGCGACCCGACGATAAAGGACAAGCTCTTGGTCAAC
ATGATGGCCCCGAAGAGCCTGGATTTGAAGATTAACGCGCAGGTGATGCTCATCAAGAATCTCGACGACACGCTC
GTCAACGGGTCGCTGGGAAAGGTGATTGCCTTTTCAGACGAAAACACTTTTGAGATGAGCAGCGACGCGCCGCGA
GAAGAGGCCATGGAAGATGACTTGGCCAAGGCCAAGCGGAAGCTGGCTAGTTTCAGTCACGATCCGGAGGGAGCT
TCGCGAGGAAGCAAGCCGTTGTTCCCCGTGGTACGATTCATATCAACTGGAGGCAAGCCGCGCGTCATCCTCTGC
CAGCCCGAGGAGTGGAAGGTGGAGCTGCCCAACGGCGAGGTGCAGGCGAAGCGAGCCCAGCTGCCGCTGATCCTG
GCGTGGGCTCTCTCGATCCACAAGGCGCAGGGCCAGACGCTGGAGCGCGTCACGGTCGACCTGGGACGCGTCTTC
GAAAAGGGACAGGCGTATGTGGCGCTGAGCCGAGCCACGACGCAGGAAGGACTCCGGGTGCTGGGCTTCAACAAG
TCCAAGGTGATGGCGCACCAGCGGGTCATTGAGTTTTACGGCAAGCTGTACTCGGCCGAGAAGGCGTTGGGCGGC
TACTCATCGGCGAAGAAGCCCGTCAAGATGGCCGACGCTGTCGCCCAGCCGAGGCCTCAGACGGGCATGACGAGC
GCCGAGGCCATTGACCTTGATGCCGAGGAGGCCATGGCTTCTTGGGGATGA
Transcript >Ophun1|3713
ATGTTCTCCCGGGCCAAGGATCAAGGTCCGGTCGCCAAGCAGCATTCTTCTTCTTCGTCGTCATCGAGGAGCGCC
TTGGCCAAGCATCTCTTTCCTTCGAGCAGTCCCGCTGCCCCGGCCGGTGACCTGCGAGATCAATTCCGCAAGATG
GGCTCTGCGGCCGCTCCCACGGTACAGTCGCCGCCGAGCGTTTCCCTCGGTGGCCGCTCGCCCGCCAACGCGTCC
ACTCGTCCTGCCAAGGCTGGACAGCTGCAGTCGCTGTACGGCAACTCTGATTCCTTCAAACAGGAGGCTGTTGGT
AGAGGCCTGAACGTGGCCGCCAGCACCAGCAATTCTCAGGCTGTGTACTTTGCGGAGAGCGACTTTAGCGACGAT
GAGAATCTCGACCTGGACTACGAGGCTCCGCAAGCTCTTCCGCCTCTGCCGAAAGCTACCATGCCCCCGCCTCCT
GTGCCGGCACAGTCTGATACGCTCATCCCGTGGTCCTCTTCCCCGAATACCCATTTCCATCCTCCCAAGGCTCGC
CAACCAATCAAGCCGCCCTTGAAGCGCGATTCGTCCGGCGAAGTCGACGACCTCGACCCTTCTGCTCAGAAGAGG
GCCAAGAAGCGAGTGCTGCCGGCCAACTTCCGGCAAACCGAGCCCGATGTGGTGGAAATGCCGCGGGGAGATGTC
GGCGCCGCCCGGAAGGCGGCCTTGTTGTGGGATGACTTGCTCCCCAGCGCCGACGATGTACAGAAGAAGCTGCCT
AGGGATCAGCGGAACCTGCAACGAGGCGATTCAAAGGGTAACGTCGGATCTCGTGCTCCATCTCCGGCCAAGGCG
GTCCCCATCACCTTGAGCACCGAGCAGCTGCACGTACTGGATCTGGTCGTCAAAAAGGGCCGGAGCGTCTTCTTC
ACCGGCCCCGCTGGTACGGGCAAGTCGGTGCTCATGAAGTCCATCATCCGCGAGCTCAAGGACAAGCACCGCCGG
GACCCCGAGCGGGTGGCCGTGACGGCGTCTACTGGGTTGGCCGCCTGCAACATCGGAGGCATTACCCTGCACAGT
TTCTCGGGCATCGGTCTCGGTAAAGAAGACGCCCAAACGCTGGTCAAGAAGATTCGGCGAAACCCAAAGGCGAAA
AAGCGGTGGGAGAGGACAAAGGTTCTCATCATCGACGAGGTCTCCATGGTGGATGGGGCCCTCTTCGACAAGCTG
TCCACCATCGGGCGCATCTTGCGCAACAATGGCCGGCCCTGGGGCGGTATCCAGCTCGTCATCACCGGTGACTTC
TTCCAGCTGCCGCCCGTGCCAGACAACAGCAATCAAGAGCCGACCAAGTTCGCCTTTGACGCGTCTACGTGGAGC
ACGTCGATTGACCACACCATCGGCCTCACCCAAGTCTTTCGGCAGCGCGACCCCAAGTTTGCCGGCATGCTCAAC
GAGCTGCGGTTGGGCAAGATTAGCAGCGACACCGAGGAGGCCTTTAAAAGCTTGTCGAGACCGCTCATCTTTGAC
GACGGCGTCGACTCGGCCCAGCTGTATCCGACCCGGCAGCAGGTTGAGAGCTCCAACGAGAAGCGGCTTCGGGAG
CTGCCCGGACAGGTTCACCGGTTCCAGGCGACCGATTCGGGCGACCCGACGATAAAGGACAAGCTCTTGGTCAAC
ATGATGGCCCCGAAGAGCCTGGATTTGAAGATTAACGCGCAGGTGATGCTCATCAAGAATCTCGACGACACGCTC
GTCAACGGGTCGCTGGGAAAGGTGATTGCCTTTTCAGACGAAAACACTTTTGAGATGAGCAGCGACGCGCCGCGA
GAAGAGGCCATGGAAGATGACTTGGCCAAGGCCAAGCGGAAGCTGGCTAGTTTCAGTCACGATCCGGAGGGAGCT
TCGCGAGGAAGCAAGCCGTTGTTCCCCGTGGTACGATTCATATCAACTGGAGGCAAGCCGCGCGTCATCCTCTGC
CAGCCCGAGGAGTGGAAGGTGGAGCTGCCCAACGGCGAGGTGCAGGCGAAGCGAGCCCAGCTGCCGCTGATCCTG
GCGTGGGCTCTCTCGATCCACAAGGCGCAGGGCCAGACGCTGGAGCGCGTCACGGTCGACCTGGGACGCGTCTTC
GAAAAGGGACAGGCGTATGTGGCGCTGAGCCGAGCCACGACGCAGGAAGGACTCCGGGTGCTGGGCTTCAACAAG
TCCAAGGTGATGGCGCACCAGCGGGTCATTGAGTTTTACGGCAAGCTGTACTCGGCCGAGAAGGCGTTGGGCGGC
TACTCATCGGCGAAGAAGCCCGTCAAGATGGCCGACGCTGTCGCCCAGCCGAGGCCTCAGACGGGCATGACGAGC
GCCGAGGCCATTGACCTTGATGCCGAGGAGGCCATGGCTTCTTGGGGATGA
Gene >Ophun1|3713
ATGTTCTCCCGGGCCAAGGATCAAGGTCCGGTCGCCAAGCAGCATTCTTCTTCTTCGTCGTCATCGAGGAGCGCC
TTGGCCAAGCATCTCTTTCCTTCGAGCAGTCCCGCTGCCCCGGCCGGTGACCTGCGAGATCAATTCCGCAAGATG
GGCTCTGCGGCCGCTCCCACGGTACAGTCGCCGCCGAGCGTTTCCCTCGGTGGCCGCTCGCCCGCCAACGCGTCC
ACTCGTCCTGCCAAGGCTGGACAGCTGCAGTCGCTGTACGGCAACTCTGATTCCTTCAAACAGGAGGCTGTTGGT
AGAGGCCTGAACGTGGCCGCCAGCACCAGCAATTCTCAGGCTGTGTACTTTGCGGAGAGCGACTTTAGCGACGAT
GAGAATCTCGACCTGGACTACGAGGCTCCGCAAGCTCTTCCGCCTCTGCCGAAAGCTACCATGCCCCCGCCTCCT
GTGCCGGCACAGTCTGATACGCTCATCCCGTGGTCCTCTTCCCCGAATACCCATTTCCATCCTCCCAAGGCTCGC
CAACCAATCAAGCCGCCCTTGAAGCGCGATTCGTCCGGCGAAGTCGACGACCTCGACCCTTCTGCTCAGAAGAGG
GCCAAGAAGCGAGTGCTGCCGGCCAACTTCCGGCAAACCGAGCCCGATGTGGTGGAAATGCCGCGGGGAGATGTC
GGCGCCGCCCGGAAGGCGGCCTTGTTGTGGGATGACTTGCTCCCCAGCGCCGACGATGTACAGAAGAAGCTGCCT
AGGGATCAGCGGAACCTGCAACGAGGCGATTCAAAGGGTAACGTCGGATCTCGTGCTCCATCTCCGGCCAAGGCG
GTCCCCATCACCTTGAGCACCGAGCAGCTGCACGTACTGGATCTGGTCGTCAAAAAGGGCCGGAGCGTCTTCTTC
ACCGGCCCCGCTGGTACGGGCAAGTCGGTGCTCATGAAGTCCATCATCCGCGAGCTCAAGGACAAGCACCGCCGG
GACCCCGAGCGGGTGGCCGTGACGGCGTCTACTGGGTTGGCCGCCTGCAACATCGGAGGCATTACCCTGCACAGT
TTCTCGGGTAAGTCTTTATTTTCTGCTCTGGCCCCTTTTTCTACCCTCGGTCCGCTCACGGCTTGTCAGGCATCG
GTCTCGGTAAAGAAGACGCCCAAACGCTGGTCAAGAAGATTCGGCGAAACCCAAAGGCGAAAAAGCGGTGGGAGA
GGACAAAGGTTCTCATCATCGACGAGGTCTCCATGGTGGATGGGGCCCTCTTCGACAAGCTGTCCACCATCGGGC
GCATCTTGCGCAACAATGGCCGGCCCTGGGGCGGTATCCAGCTCGTCATCACCGGTGACTTCTTCCAGCTGCCGC
CCGTGCCAGACAACAGCAATCAAGAGCCGACCAAGTTCGCCTTTGACGCGTCTACGTGGAGCACGTCGATTGACC
ACACCATCGGCCTCACCCAAGTCTTTCGGCAGCGCGACCCCAAGTTTGCCGGCATGCTCAACGAGCTGCGGTTGG
GCAAGATTAGCAGCGACACCGAGGAGGCCTTTAAAAGCTTGTCGAGACCGCTCATCTTTGACGACGGCGTCGACT
CGGCCCAGCTGTATCCGACCCGGCAGCAGGTTGAGAGCTCCAACGAGAAGCGGCTTCGGGAGCTGCCCGGACAGG
TTCACCGGTTCCAGGCGACCGATTCGGGCGACCCGACGATAAAGGACAAGCTCTTGGTCAACATGATGGCCCCGA
AGAGCCTGGATTTGAAGATTAACGCGCAGGTGATGCTCATCAAGAATCTCGACGACACGCTCGTCAACGGGTCGC
TGGGAAAGGTGATTGCCTTTTCAGACGAAAACACTTTTGAGATGAGCAGCGACGCGCCGCGAGAAGAGGCCATGG
AAGATGACTTGGCCAAGGCCAAGCGGAAGCTGGCTAGTTTCAGTCACGATCCGGAGGGAGCTTCGCGAGGAAGCA
AGCCGTTGTTCCCCGTGGTACGATTCATATCAACTGGAGGCAAGCCGCGCGTCATCCTCTGCCAGCCCGAGGAGT
GGAAGGTGGAGCTGCCCAACGGCGAGGTGCAGGCGAAGCGAGCCCAGCTGCCGCTGATCCTGGCGTGGGCTCTCT
CGATCCACAAGGCGCAGGGCCAGACGCTGGAGCGCGTCACGGTCGACCTGGGACGCGTCTTCGAAAAGGGACAGG
CGTATGTGGCGCTGAGCCGAGCCACGACGCAGGAAGGACTCCGGGTGCTGGGCTTCAACAAGTCCAAGGTGATGG
CGCACCAGCGGGTCATTGAGTTTTACGGCAAGCTGTACTCGGCCGAGAAGGCGTTGGGCGGCTACTCATCGGCGA
AGAAGCCCGTCAAGATGGCCGACGCTGTCGCCCAGCCGAGGCCTCAGACGGGCATGACGAGCGCCGAGGCCATTG
ACCTTGATGCCGAGGAGGCCATGGCTTCTTGGGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail