Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3710
Gene name
LocationContig_331:11142..11460
Strand+
Gene length (bp)318
Transcript length (bp)318
Coding sequence length (bp)318
Protein length (aa) 106

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 5.5E-06 23 89
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.3E-04 24 54

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 23 76 7.0E-09

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3710
MLPDAATLPLFASCRAPRCVRFVIAGAGIAGLTTGLGLRLTGHDVTILDQASDLDEAGAGIQIAPNATRVLARLG
VLDQVVEDADVLERISIRQAPFPRWNKPGS*
Coding >Ophun1|3710
ATGCTCCCCGACGCTGCGACCCTCCCGTTGTTCGCCTCTTGTCGAGCCCCTCGCTGCGTCCGCTTCGTGATAGCT
GGTGCCGGTATTGCGGGACTCACCACGGGCCTCGGTCTCCGATTGACGGGCCACGATGTCACCATCCTCGACCAA
GCCTCTGACCTAGACGAGGCCGGCGCCGGCATTCAGATTGCGCCCAATGCCACTCGCGTCCTCGCTCGTCTCGGC
GTTCTCGATCAAGTCGTAGAGGATGCCGACGTGCTCGAGCGCATATCCATACGGCAAGCTCCCTTTCCTCGATGG
AATAAACCTGGCTCATGA
Transcript >Ophun1|3710
ATGCTCCCCGACGCTGCGACCCTCCCGTTGTTCGCCTCTTGTCGAGCCCCTCGCTGCGTCCGCTTCGTGATAGCT
GGTGCCGGTATTGCGGGACTCACCACGGGCCTCGGTCTCCGATTGACGGGCCACGATGTCACCATCCTCGACCAA
GCCTCTGACCTAGACGAGGCCGGCGCCGGCATTCAGATTGCGCCCAATGCCACTCGCGTCCTCGCTCGTCTCGGC
GTTCTCGATCAAGTCGTAGAGGATGCCGACGTGCTCGAGCGCATATCCATACGGCAAGCTCCCTTTCCTCGATGG
AATAAACCTGGCTCATGA
Gene >Ophun1|3710
ATGCTCCCCGACGCTGCGACCCTCCCGTTGTTCGCCTCTTGTCGAGCCCCTCGCTGCGTCCGCTTCGTGATAGCT
GGTGCCGGTATTGCGGGACTCACCACGGGCCTCGGTCTCCGATTGACGGGCCACGATGTCACCATCCTCGACCAA
GCCTCTGACCTAGACGAGGCCGGCGCCGGCATTCAGATTGCGCCCAATGCCACTCGCGTCCTCGCTCGTCTCGGC
GTTCTCGATCAAGTCGTAGAGGATGCCGACGTGCTCGAGCGCATATCCATACGGCAAGCTCCCTTTCCTCGATGG
AATAAACCTGGCTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail