Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3709
Gene name
LocationContig_331:6913..9139
Strand-
Gene length (bp)2226
Transcript length (bp)2226
Coding sequence length (bp)2226
Protein length (aa) 742

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08733 PalH PalH/RIM21 4.1E-103 65 374

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RY98|PALH_NEUCR pH-response regulator protein palH/prr-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prr-4 PE=3 SV=1 74 672 0.0E+00
sp|Q5V9L7|PALH_BOTFB pH-response regulator protein palH/RIM21 OS=Botryotinia fuckeliana (strain B05.10) GN=palH PE=3 SV=2 61 675 2.0E-147
sp|Q52E66|PALH_MAGO7 pH-response regulator protein palH/RIM21 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RIM21 PE=3 SV=1 8 522 4.0E-146
sp|Q9P904|PALH_EMENI pH-response regulator protein palH/RIM21 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=palH PE=3 SV=1 68 657 1.0E-117
sp|Q9UVF6|PALH_YARLI pH-response regulator protein palH/RIM21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RIM21 PE=3 SV=2 74 371 7.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RY98|PALH_NEUCR pH-response regulator protein palH/prr-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prr-4 PE=3 SV=1 74 672 0.0E+00
sp|Q5V9L7|PALH_BOTFB pH-response regulator protein palH/RIM21 OS=Botryotinia fuckeliana (strain B05.10) GN=palH PE=3 SV=2 61 675 2.0E-147
sp|Q52E66|PALH_MAGO7 pH-response regulator protein palH/RIM21 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RIM21 PE=3 SV=1 8 522 4.0E-146
sp|Q9P904|PALH_EMENI pH-response regulator protein palH/RIM21 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=palH PE=3 SV=1 68 657 1.0E-117
sp|Q9UVF6|PALH_YARLI pH-response regulator protein palH/RIM21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RIM21 PE=3 SV=2 74 371 7.0E-38
sp|Q52E66|PALH_MAGO7 pH-response regulator protein palH/RIM21 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RIM21 PE=3 SV=1 616 672 4.0E-14
sp|Q6CXK7|PALH_KLULA pH-response regulator protein palH/RIM21 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RIM21 PE=3 SV=1 73 368 4.0E-12
sp|Q6BPR6|PALH_DEBHA pH-response regulator protein palH/RIM21 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RIM21 PE=3 SV=2 141 367 6.0E-12
sp|P48565|PALH_YEAST pH-response regulator protein palH/RIM21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM21 PE=1 SV=1 131 365 4.0E-11
sp|Q758G4|PALH_ASHGO pH-response regulator protein palH/RIM21 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RIM21 PE=3 SV=1 75 368 2.0E-09
sp|Q59YK4|PALH_CANAL pH-response regulator protein palH/RIM21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RIM21 PE=3 SV=1 71 367 2.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 81 103 22
2 215 237 22
3 252 274 22
4 294 316 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3709
METLTYPSTAATLCTTTSLVPAKGFLAMTAGPSSQTVVYEVPCPTLNPVVAVVAAEQRPDTHDGSSDARISVTDP
FSASTFPICYALAAATVTAYMLLIMLFITPRSFLDGGVVYLGRRRGFTHSSSGGENIGGRPWLQKVATLTVAVSL
TIATHETFKIVQRQYQFGAQNAGVLQSSVMGKPELLAIRLISDTFLWLAQAQTLIRLFPRHREKVIIKWAAFALI
TLDLIFTALSSFKKGGFNPLVDGSFSHPITALSYLFQLLLGVLYAAWVIYYSLMKKRYAFYHPLMKNMPLLAIIS
LTSILIPVVFFVMDFIKREFTGWGDYVRWVGAAAASVIVWEWVERIEALEREEKKDGILGREVFDGDDTLEVNAS
DSPWLRHRKKGGGGDDDDEYGDCVGGGDFYYHDQDHRQHRHHHHHHHHLHDHGHHHHRRGAGSGSGNGQRHQWPL
RPNGWPGVSAMTGRQQTQAHDAPLRTMSDMLRPPLWPSRPAPTVTPVSRTDTPSAASTVYAVRYQGTSDTTSRTP
DPPASTPDPQPLAQADDDDAPPAMDLATAASATAVAATTSGRPRRWRALTTLGARSPAPSSGDKEKEAEEEVHRL
ATRDMVVEPHGDSRDEASRWDIRSRLELFAATQAEKLREKLRPTAETESLPVTVIPAPPRQGTALRRVLEEETTS
GAAVSTMDRGDSWTEDDSPTNPPLWPGVGRERVLGFEETDLGVDDSLSEAETASMEDDDEDEVSRV*
Coding >Ophun1|3709
ATGGAGACTTTGACCTATCCCTCGACGGCGGCGACGCTGTGCACAACCACCAGCTTGGTGCCCGCCAAGGGCTTC
TTGGCAATGACGGCCGGTCCATCCTCACAAACTGTCGTCTACGAGGTGCCCTGTCCGACCTTGAACCCCGTCGTC
GCCGTCGTCGCCGCAGAGCAGAGGCCCGACACCCACGACGGCTCCTCGGACGCCCGCATCTCCGTCACCGACCCC
TTCTCTGCTTCCACCTTTCCTATCTGCTACGCCCTCGCCGCCGCCACCGTCACCGCCTACATGCTCCTCATCATG
CTCTTCATCACCCCGCGCTCCTTTCTCGACGGCGGCGTCGTCTACCTCGGCCGCCGCCGCGGCTTCACCCACAGC
TCCTCGGGCGGCGAGAACATTGGCGGCCGTCCCTGGCTACAAAAGGTGGCCACCCTCACCGTCGCCGTCTCCCTC
ACCATCGCCACCCACGAAACGTTCAAGATCGTCCAGCGTCAGTACCAATTTGGCGCCCAGAACGCCGGCGTCCTG
CAGAGCTCCGTCATGGGCAAGCCCGAGCTTCTTGCCATCCGCCTCATCTCCGACACCTTTCTCTGGCTAGCCCAG
GCCCAGACGTTGATCCGGCTCTTTCCCCGTCACCGGGAAAAGGTTATCATCAAGTGGGCCGCCTTTGCCCTCATC
ACGCTCGACCTCATCTTCACCGCCCTCAGCAGCTTCAAGAAGGGAGGCTTCAACCCCCTCGTCGACGGCAGCTTC
AGCCACCCCATCACCGCCCTCAGCTACCTCTTCCAGCTCCTGCTCGGCGTCCTCTACGCCGCCTGGGTCATCTAC
TACTCACTCATGAAGAAGCGCTACGCCTTTTACCATCCGCTCATGAAGAACATGCCGCTGCTGGCCATCATCTCC
CTCACGTCCATCCTCATCCCCGTCGTCTTCTTCGTCATGGACTTTATCAAGCGCGAGTTCACCGGCTGGGGCGAC
TATGTGCGCTGGGTCGGCGCCGCGGCCGCCAGCGTCATCGTGTGGGAGTGGGTCGAGCGCATCGAGGCGCTCGAG
CGCGAGGAGAAGAAGGACGGTATCCTCGGCCGCGAGGTGTTTGACGGCGACGACACGCTCGAGGTCAACGCGTCG
GATTCTCCCTGGCTGCGACATCGCAAAAAGGGGGGTGGCGGTGACGACGACGACGAATACGGCGACTGCGTGGGA
GGCGGCGACTTCTACTACCATGACCAAGACCACCGTCAGCACCGCCATCACCATCACCACCACCATCACCTCCAC
GACCATGGCCACCACCATCACCGCCGCGGTGCCGGGAGCGGCAGCGGCAACGGCCAACGCCACCAGTGGCCGCTG
CGCCCCAACGGCTGGCCCGGGGTGTCGGCCATGACGGGCCGGCAACAGACGCAAGCGCACGACGCGCCGCTGCGG
ACCATGAGCGACATGTTACGGCCGCCGCTGTGGCCTTCGCGGCCGGCGCCGACGGTGACGCCCGTTAGCCGGACG
GACACGCCGAGCGCGGCCAGCACCGTGTACGCGGTGCGGTACCAAGGCACGTCTGACACGACGTCTCGGACGCCG
GATCCGCCAGCATCGACGCCGGATCCACAGCCGCTAGCGCAGGCCGACGACGATGACGCCCCACCGGCCATGGAC
TTGGCGACGGCGGCCTCGGCGACGGCGGTGGCGGCGACAACGTCGGGGAGGCCGAGGCGGTGGCGCGCGCTTACG
ACGCTGGGAGCGAGAAGCCCGGCGCCGTCTTCGGGCGACAAGGAGAAGGAGGCAGAGGAAGAGGTGCATCGGCTG
GCGACGCGGGACATGGTGGTGGAGCCGCACGGTGACAGCCGAGACGAGGCGAGCCGGTGGGACATACGGTCGCGG
CTGGAGTTGTTCGCGGCCACTCAGGCGGAGAAGCTGCGGGAGAAGCTACGGCCGACGGCGGAAACGGAGAGCCTG
CCGGTGACGGTGATACCGGCGCCGCCGCGGCAGGGCACGGCGCTTCGTCGGGTGCTGGAGGAGGAGACGACGTCG
GGAGCGGCGGTGTCGACGATGGACAGGGGCGACAGCTGGACGGAGGACGATTCGCCGACGAACCCTCCGCTGTGG
CCCGGAGTTGGGCGCGAGCGGGTGCTGGGATTCGAGGAGACGGATCTCGGGGTGGACGACTCGCTCTCGGAGGCG
GAGACGGCGTCGATGGAGGACGACGACGAGGACGAGGTGTCGAGGGTGTGA
Transcript >Ophun1|3709
ATGGAGACTTTGACCTATCCCTCGACGGCGGCGACGCTGTGCACAACCACCAGCTTGGTGCCCGCCAAGGGCTTC
TTGGCAATGACGGCCGGTCCATCCTCACAAACTGTCGTCTACGAGGTGCCCTGTCCGACCTTGAACCCCGTCGTC
GCCGTCGTCGCCGCAGAGCAGAGGCCCGACACCCACGACGGCTCCTCGGACGCCCGCATCTCCGTCACCGACCCC
TTCTCTGCTTCCACCTTTCCTATCTGCTACGCCCTCGCCGCCGCCACCGTCACCGCCTACATGCTCCTCATCATG
CTCTTCATCACCCCGCGCTCCTTTCTCGACGGCGGCGTCGTCTACCTCGGCCGCCGCCGCGGCTTCACCCACAGC
TCCTCGGGCGGCGAGAACATTGGCGGCCGTCCCTGGCTACAAAAGGTGGCCACCCTCACCGTCGCCGTCTCCCTC
ACCATCGCCACCCACGAAACGTTCAAGATCGTCCAGCGTCAGTACCAATTTGGCGCCCAGAACGCCGGCGTCCTG
CAGAGCTCCGTCATGGGCAAGCCCGAGCTTCTTGCCATCCGCCTCATCTCCGACACCTTTCTCTGGCTAGCCCAG
GCCCAGACGTTGATCCGGCTCTTTCCCCGTCACCGGGAAAAGGTTATCATCAAGTGGGCCGCCTTTGCCCTCATC
ACGCTCGACCTCATCTTCACCGCCCTCAGCAGCTTCAAGAAGGGAGGCTTCAACCCCCTCGTCGACGGCAGCTTC
AGCCACCCCATCACCGCCCTCAGCTACCTCTTCCAGCTCCTGCTCGGCGTCCTCTACGCCGCCTGGGTCATCTAC
TACTCACTCATGAAGAAGCGCTACGCCTTTTACCATCCGCTCATGAAGAACATGCCGCTGCTGGCCATCATCTCC
CTCACGTCCATCCTCATCCCCGTCGTCTTCTTCGTCATGGACTTTATCAAGCGCGAGTTCACCGGCTGGGGCGAC
TATGTGCGCTGGGTCGGCGCCGCGGCCGCCAGCGTCATCGTGTGGGAGTGGGTCGAGCGCATCGAGGCGCTCGAG
CGCGAGGAGAAGAAGGACGGTATCCTCGGCCGCGAGGTGTTTGACGGCGACGACACGCTCGAGGTCAACGCGTCG
GATTCTCCCTGGCTGCGACATCGCAAAAAGGGGGGTGGCGGTGACGACGACGACGAATACGGCGACTGCGTGGGA
GGCGGCGACTTCTACTACCATGACCAAGACCACCGTCAGCACCGCCATCACCATCACCACCACCATCACCTCCAC
GACCATGGCCACCACCATCACCGCCGCGGTGCCGGGAGCGGCAGCGGCAACGGCCAACGCCACCAGTGGCCGCTG
CGCCCCAACGGCTGGCCCGGGGTGTCGGCCATGACGGGCCGGCAACAGACGCAAGCGCACGACGCGCCGCTGCGG
ACCATGAGCGACATGTTACGGCCGCCGCTGTGGCCTTCGCGGCCGGCGCCGACGGTGACGCCCGTTAGCCGGACG
GACACGCCGAGCGCGGCCAGCACCGTGTACGCGGTGCGGTACCAAGGCACGTCTGACACGACGTCTCGGACGCCG
GATCCGCCAGCATCGACGCCGGATCCACAGCCGCTAGCGCAGGCCGACGACGATGACGCCCCACCGGCCATGGAC
TTGGCGACGGCGGCCTCGGCGACGGCGGTGGCGGCGACAACGTCGGGGAGGCCGAGGCGGTGGCGCGCGCTTACG
ACGCTGGGAGCGAGAAGCCCGGCGCCGTCTTCGGGCGACAAGGAGAAGGAGGCAGAGGAAGAGGTGCATCGGCTG
GCGACGCGGGACATGGTGGTGGAGCCGCACGGTGACAGCCGAGACGAGGCGAGCCGGTGGGACATACGGTCGCGG
CTGGAGTTGTTCGCGGCCACTCAGGCGGAGAAGCTGCGGGAGAAGCTACGGCCGACGGCGGAAACGGAGAGCCTG
CCGGTGACGGTGATACCGGCGCCGCCGCGGCAGGGCACGGCGCTTCGTCGGGTGCTGGAGGAGGAGACGACGTCG
GGAGCGGCGGTGTCGACGATGGACAGGGGCGACAGCTGGACGGAGGACGATTCGCCGACGAACCCTCCGCTGTGG
CCCGGAGTTGGGCGCGAGCGGGTGCTGGGATTCGAGGAGACGGATCTCGGGGTGGACGACTCGCTCTCGGAGGCG
GAGACGGCGTCGATGGAGGACGACGACGAGGACGAGGTGTCGAGGGTGTGA
Gene >Ophun1|3709
ATGGAGACTTTGACCTATCCCTCGACGGCGGCGACGCTGTGCACAACCACCAGCTTGGTGCCCGCCAAGGGCTTC
TTGGCAATGACGGCCGGTCCATCCTCACAAACTGTCGTCTACGAGGTGCCCTGTCCGACCTTGAACCCCGTCGTC
GCCGTCGTCGCCGCAGAGCAGAGGCCCGACACCCACGACGGCTCCTCGGACGCCCGCATCTCCGTCACCGACCCC
TTCTCTGCTTCCACCTTTCCTATCTGCTACGCCCTCGCCGCCGCCACCGTCACCGCCTACATGCTCCTCATCATG
CTCTTCATCACCCCGCGCTCCTTTCTCGACGGCGGCGTCGTCTACCTCGGCCGCCGCCGCGGCTTCACCCACAGC
TCCTCGGGCGGCGAGAACATTGGCGGCCGTCCCTGGCTACAAAAGGTGGCCACCCTCACCGTCGCCGTCTCCCTC
ACCATCGCCACCCACGAAACGTTCAAGATCGTCCAGCGTCAGTACCAATTTGGCGCCCAGAACGCCGGCGTCCTG
CAGAGCTCCGTCATGGGCAAGCCCGAGCTTCTTGCCATCCGCCTCATCTCCGACACCTTTCTCTGGCTAGCCCAG
GCCCAGACGTTGATCCGGCTCTTTCCCCGTCACCGGGAAAAGGTTATCATCAAGTGGGCCGCCTTTGCCCTCATC
ACGCTCGACCTCATCTTCACCGCCCTCAGCAGCTTCAAGAAGGGAGGCTTCAACCCCCTCGTCGACGGCAGCTTC
AGCCACCCCATCACCGCCCTCAGCTACCTCTTCCAGCTCCTGCTCGGCGTCCTCTACGCCGCCTGGGTCATCTAC
TACTCACTCATGAAGAAGCGCTACGCCTTTTACCATCCGCTCATGAAGAACATGCCGCTGCTGGCCATCATCTCC
CTCACGTCCATCCTCATCCCCGTCGTCTTCTTCGTCATGGACTTTATCAAGCGCGAGTTCACCGGCTGGGGCGAC
TATGTGCGCTGGGTCGGCGCCGCGGCCGCCAGCGTCATCGTGTGGGAGTGGGTCGAGCGCATCGAGGCGCTCGAG
CGCGAGGAGAAGAAGGACGGTATCCTCGGCCGCGAGGTGTTTGACGGCGACGACACGCTCGAGGTCAACGCGTCG
GATTCTCCCTGGCTGCGACATCGCAAAAAGGGGGGTGGCGGTGACGACGACGACGAATACGGCGACTGCGTGGGA
GGCGGCGACTTCTACTACCATGACCAAGACCACCGTCAGCACCGCCATCACCATCACCACCACCATCACCTCCAC
GACCATGGCCACCACCATCACCGCCGCGGTGCCGGGAGCGGCAGCGGCAACGGCCAACGCCACCAGTGGCCGCTG
CGCCCCAACGGCTGGCCCGGGGTGTCGGCCATGACGGGCCGGCAACAGACGCAAGCGCACGACGCGCCGCTGCGG
ACCATGAGCGACATGTTACGGCCGCCGCTGTGGCCTTCGCGGCCGGCGCCGACGGTGACGCCCGTTAGCCGGACG
GACACGCCGAGCGCGGCCAGCACCGTGTACGCGGTGCGGTACCAAGGCACGTCTGACACGACGTCTCGGACGCCG
GATCCGCCAGCATCGACGCCGGATCCACAGCCGCTAGCGCAGGCCGACGACGATGACGCCCCACCGGCCATGGAC
TTGGCGACGGCGGCCTCGGCGACGGCGGTGGCGGCGACAACGTCGGGGAGGCCGAGGCGGTGGCGCGCGCTTACG
ACGCTGGGAGCGAGAAGCCCGGCGCCGTCTTCGGGCGACAAGGAGAAGGAGGCAGAGGAAGAGGTGCATCGGCTG
GCGACGCGGGACATGGTGGTGGAGCCGCACGGTGACAGCCGAGACGAGGCGAGCCGGTGGGACATACGGTCGCGG
CTGGAGTTGTTCGCGGCCACTCAGGCGGAGAAGCTGCGGGAGAAGCTACGGCCGACGGCGGAAACGGAGAGCCTG
CCGGTGACGGTGATACCGGCGCCGCCGCGGCAGGGCACGGCGCTTCGTCGGGTGCTGGAGGAGGAGACGACGTCG
GGAGCGGCGGTGTCGACGATGGACAGGGGCGACAGCTGGACGGAGGACGATTCGCCGACGAACCCTCCGCTGTGG
CCCGGAGTTGGGCGCGAGCGGGTGCTGGGATTCGAGGAGACGGATCTCGGGGTGGACGACTCGCTCTCGGAGGCG
GAGACGGCGTCGATGGAGGACGACGACGAGGACGAGGTGTCGAGGGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail